KEGG   Ajellomyces capsulatus: HCAG_02601Help
Entry
HCAG_02601        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
aje  Ajellomyces capsulatus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HCAG_02601
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     HCAG_02601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 637 aa AA seqDB search
MAFLKVALAGLWLSSIASASFSSNLNYRSPSHNHPDLGIAINKVQKRNVQSSPFKPEELH
FTHNVASGDPYSHSVILWTRISPTKESSGSNVTVTGTAPLYDHDNDKYVAVSTAPVCVEY
KVAKDDKMRRVVTDGEVWTSSDVDYTVKVEATDLKPYTTYYYQFTVCDSKNSSPIGRTKT
TPRKSDRVRKDINLSVFSCSNYPQGFFNAYGNAARKDTADYVVHLGDYIYEYKEDIKIPK
PDLICYKGGYGWGWSMDRIPQPSDHNVKTLLDYRMRYASYRTDADLVYSHQHFPWITVWD
DHEVEDNIWKAGSSKMNNTEESFIKAGGISIDQSKANAVRAHFEWMPIRQVDMDDNLRIW
RNFEIGDLFSLIMLDTRVYDRSITDVTWNREYLDEIRDEQSRSLLGPRQETWFYRQLRES
AKRRTKWRIVGQQVLISDISYADSKPETPYNADAWDGYRANKNRTLATILNNQIDNTIFL
AGDTHASYVSDLVYTGLGEYDSKSGSGAIGVEFGGSGVTSPGPVGQNGTLAKGAEQSKTF
VKNSTPLQWQDSYYRGYYELKINHERVIADFFGVPDIRTRNGKEIKLATFEVLDGANKLT
RNEKGEPVVGQAVGGALKHGEVHPDAAVIVDTMKKEN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcttaaggttgccctggcggggctctggctgagctcaattgcatctgcgtca
ttctcctccaatttgaactaccgctctccttcccataatcaccccgatcttggaattgcc
attaacaaggttcaaaagcggaatgtccaatcctctccatttaaacccgaggagctgcac
ttcactcataatgttgcttctggagatccttactcccattcggtgatcctctggactcga
atctcacccacgaaggagagcagtggttccaacgtgactgtgactgggacggcacctctg
tatgaccatgacaacgacaaatacgttgcagtttctactgcaccagtttgcgtggagtac
aaggtggcaaaggatgacaagatgaggagagttgtcaccgatggagaagtttggacttcc
tccgatgttgactatacagtcaaggttgaagcaactgacctcaaaccatacacgacttac
tattatcaatttacagtttgtgactcgaagaactcttccccgattgggcgcaccaaaaca
acccccagaaagtccgacagagtgaggaaggatatcaatctttctgtcttctcttgctcc
aactatccccaggggtttttcaatgcttacggaaatgctgcccgtaaggacactgccgac
tacgttgtccaccttggtgactatatttatgaatacaaagaggatatcaagattccaaaa
cctgacctgatatgctataaaggtggctacggatggggatggtccatggatcgcattcca
cagccttcagatcacaatgtcaagaccctactcgattatcgcatgagatacgccagttac
cgtactgacgccgacctcgtttactcgcatcaacatttcccttggattaccgtttgggat
gaccatgaggtagaagacaacatctggaaggccggctcatccaaaatgaacaacacggaa
gaatccttcatcaaggccggtggaatttccattgaccaatctaaagcaaatgctgtccgt
gctcatttcgagtggatgcctattcgtcaggttgacatggatgacaaccttcgtatctgg
cgcaatttcgagattggcgatctattcagccttatcatgcttgatacccgtgtctatgat
cgctccatcaccgatgttacctggaatagagagtacctcgacgagatccgtgatgagcaa
tcccgctctctgttagggccccgccaggagacgtggttctaccgccagctccgagaatct
gccaagcgaagaaccaaatggagaatcgtcggccagcaagtcctcatctctgacatcagc
tacgccgattctaagccagaaaccccctataacgctgacgcctgggatggataccgggcc
aacaaaaatcgaaccctcgcaacgattctcaacaaccaaattgacaataccatttttctt
gctggtgacactcatgcttcctacgtctctgacctcgtctacaccggccttggtgaatac
gattccaaatccggatccggagccatcggtgttgagtttggtggctccggcgtcacctcc
cccggccccgtcggccaaaacggcactctagccaagggagccgaacagtccaagacgttt
gtcaagaacagcactcccctgcaatggcaagattcttactatcgtggctactacgaactc
aagatcaaccatgagcgcgtcattgcggatttctttggtgttcctgacatccgcacacgc
aacggaaaagaaatcaaacttgcgacgtttgaggttctggacggtgcgaataagctcact
agaaatgagaagggagaacctgttgttgggcaggccgttggcggggcacttaagcatggc
gaagttcatccggatgctgctgtgattgtagataccatgaagaaagagaattaa

DBGET integrated database retrieval system