KEGG   Ajellomyces capsulatus: HCAG_02731Help
Entry
HCAG_02731        CDS       T02229                                 

Definition
similar to mannosyltransferase PMTI
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aje  Ajellomyces capsulatus
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    HCAG_02731
Enzymes [BR:aje01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     HCAG_02731
Glycosyltransferases [BR:aje01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   HCAG_02731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 776 aa AA seqDB search
MSSPPPNLRQRGGKKNVAVKDPQTISPPLKLSPHKKAVAKPAGQWDYKAALVILTLLAFA
TRFASISYPDEVVFDEVHFGKFASHYLRRTYFFDVHPPFGKLLLAFMGWLVGFDGHFLFE
NIGDSYIENRVPYVALRAMPAIQGALTIPVIFLIMWESGYSLPACILSAGLALFDNAHVA
EDRLILLDATLVLTMALSILCYVRFYKFRHEPFSRKWWKWLLLTGVSLSCVISTKYVGTF
TFVTVGAAVAIDLWDLLDVNRPGGVIPLTQFAKHFAARALALIVVPFFFYLFWFQVHFAI
LNKSGPGDAFMSPEFQQTLSDNPMNVNSFGIHYYDHITIRHRDTKTYLHSHPDRYPLRYD
DGRVSSQGQQVTGYPYNDTNNHWEILPATPFDDNDRLGHVVKNGDIIQLHHVGTDTILLT
HDVASPYYPTNQEFTTVSHELANGERHNDTLFEIKIEKGGSEQEFNTLSSHFKLIHVPTK
VAMWTHTKPLPEWGFKQAEINGNKNAQQSSNIWFAEDIPSLDPDSERLKKEPRPIKQLPF
LVKYLELQRAMFVHNNALTSSHPYASEPFEWPFLLRGVSFWTKNSEREQIYFLGNPIGWW
LSSGLLAVFAGIVGADQLSMRRGIDALEEIWGPGTRARLYRSTGFFFLCWAAHFLPFFLM
GRQRFLHHYLPAHIASTLVAGAVIEFVFNIDPIVPNDNNGDLTAAETAVTDRKYRIPKGR
LGQQSLLALWAAVGVILSATMYGFYFFAPLTYGRPGLDVAGVLARRWLSYELHFAK
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctccacccccaaacctccgacagcgaggggggaagaaaaatgtcgccgttaaa
gatccacaaacaatttctcccccactcaaattgagcccacataagaaggccgttgcaaaa
cccgccggacagtgggattataaggccgctttggtgatcttgacgctgttagcgttcgca
acacgttttgccagtataagctaccctgacgaagttgtgtttgatgaggtccatttcggg
aagtttgcttcgcattaccttcgacgcacctatttcttcgatgttcacccaccgtttggc
aagcttctccttgcttttatgggttggcttgtgggattcgacggccactttcttttcgag
aatattggagattcatacatcgaaaacagagtcccgtatgttgccctccgggccatgccc
gcgatccaaggcgctttgacgatccctgtgatcttcctaattatgtgggagtctggctac
tccctcccagcctgtatcctctctgcgggactggctctgttcgacaatgcgcacgttgct
gaagatagactgatccttctcgacgcaaccctggtgctcaccatggcactgagcatcctt
tgttacgttcggttttacaaattcagacacgagccatttagtcgcaagtggtggaaatgg
ctgcttttgactggtgtctcgctgagttgtgttatttcaactaaatacgtgggcacgttt
acgtttgtcactgttggcgccgccgttgccatcgatttgtgggatcttcttgatgtgaat
cgccctggaggcgttattcccctaactcaattcgccaagcatttcgctgctcgagctctc
gccttgattgtcgtgccatttttcttttatttgttctggttccaggttcactttgctatt
ctcaacaagtcaggtccaggcgacgcctttatgtccccggaatttcagcaaactctcagt
gataatccgatgaacgtgaactcgtttggcatccattattacgatcatataactatacga
cacagggataccaagacatatctacacagccatccagatcgctacccgttacgttatgac
gacgggcgtgtctccagccagggtcagcaagttactggctacccttacaacgacaccaac
aaccactgggagatacttccggccactccattcgatgataacgatcgccttgggcacgtt
gttaaaaatggtgacattatccaacttcaccatgtggggacagatactattctgctaacg
cacgacgtggcctccccgtattatcccacaaaccaggagttcaccaccgtttcccatgag
ctggcaaatggcgagcgccacaacgataccctctttgagatcaagatcgagaaaggagga
tcagagcaagagttcaataccttgtctagtcatttcaagcttatccatgtgcccactaag
gttgccatgtggacccataccaagcccttacctgagtggggatttaagcaagctgaaatc
aacgggaataaaaatgcgcaacagtccagtaacatctggtttgcggaggatatcccgtct
ctagacccggacagtgagcggctgaaaaaagagccccgcccgatcaaacaacttcctttc
cttgtcaagtacttagaactacaacgggcaatgttcgttcacaacaatgccctaaccagc
agccatccgtacgccagtgaaccattcgaatggcccttcctccttcgtggagtaagtttc
tggactaagaattccgagcgagagcagatctatttcctcggaaacccgatcggctggtgg
ctttcaagcggtctcctcgccgtttttgccggcattgtcggtgccgatcagctctccatg
cgtagagggattgacgccctggaagaaatctggggtcccggcacccgcgcgcgcctctac
aggagcactggtttcttcttcctctgttgggccgcccacttcctgcctttcttcctcatg
ggccgccagcgtttcctccaccattacttaccagcccacatcgcctccaccctcgtcgct
ggcgccgtaatcgaattcgtttttaacatcgatccaatagtcccgaatgacaacaacggc
gatctgacagcggctgaaactgccgtcacggatcgaaagtaccggatccccaagggacgg
ttgggtcagcagagtctgctggctctgtgggcagctgtcggcgtgattttgagcgcgacg
atgtatgggttctatttctttgcgccacttacatatggtcggcctgggttagatgttgcg
ggcgtgctggcgaggcggtggttgtcgtacgagttgcactttgcgaaataa

DBGET integrated database retrieval system