KEGG   Histoplasma capsulatum: HCAG_02739Help
Entry
HCAG_02739        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
aje  Histoplasma capsulatum
Pathway
aje00100  Steroid biosynthesis
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    HCAG_02739
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     HCAG_02739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24 DUF1295
Motif
Other DBs
NCBI-GeneID: 5448993
NCBI-ProteinID: XP_001542568
UniProt: A6QZD2
AA seq 417 aa AA seqDB search
MLACPAAIIFWYVTLHHFDGSLLSASVALRNKGFISFYREYCPVLNLRATLVYGAWVLFQ
ALLYSFLPGSTYEGQPTPAGNILKYKINGLLAVVVTVLLFGAISLRGGILASSFVATNWG
AFLAIFNIYGLFLALAFYLKAHFAPSHPEDRKFSGSPIYDLYMGIELNPRLGQSWDMKLF
HNGRPGIIGWILIDMSFTALQFLRHGYITSSIITADILHLVYIIDFFFNEHWYLKTLDMA
HDHVGFYLAWGSAAWLPTIYTLQPQFLAIHPVSLSPIAAATILTTGLGGYILFRSANDQK
YLVRETQGKCLIWGKAPKYIQCKYKTTDGSTHKSIILCSGWWGVVRHANYLGDLVLSYAM
CATCGFTHLLPWTYAIFMTTILVHRCYRDEQRCARKYGKTWEEYCEKVRWRIIPGVF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctggcatgccctgctgccattatcttctggtatgtgacgctacaccattttgatggc
tcattattgtcagcctccgtggcgctcaggaacaaggggttcatttccttttatcgcgaa
tactgccccgtccttaatctgagagctactcttgtctacggagcttgggttctttttcaa
gcgctactgtacagttttctcccagggtctacgtatgaaggacagcccacccctgctgga
aatatcctcaagtacaaaatcaacgggttgttggctgtcgttgtcactgtgctcctgttt
ggcgcgataagtctgcggggtggtattcttgcttcatcatttgtcgccacaaattggggt
gcatttctcgccatattcaatatttacggcttgtttctcgctctagctttctaccttaaa
gcccactttgcgccatcacatccagaagacagaaagttcagcgggtctcccatctacgac
ttgtatatgggaatcgagctcaacccgcggttgggccaatcatgggacatgaaacttttc
cacaatggccgtcctggtattattggttggatattaattgacatgtccttcaccgcgctc
cagtttttacggcacggatacattacgagctcaattattactgccgacatccttcacctg
gtttatattatagactttttcttcaatgagcattggtacctcaaaaccctcgatatggct
catgaccatgtcggattttatttagcttggggctcggcagcctggcttcccaccatctac
accttgcagccccaatttctagcaattcacccagtgtctctctctcctattgctgcagct
acgattctgaccactgggcttggtggatatattctgttccggtccgcaaatgaccagaaa
tacctcgtgcgtgaaacccagggcaaatgtttaatatgggggaaggcgccaaagtatatc
caatgcaagtataagaccacagatggatcgacgcacaaatctattattctatgttccgga
tggtggggagttgtccgtcatgcgaactacttgggtgatctcgtcttgtcctacgcaatg
tgtgctacctgcgggttcactcacttgctcccgtggacatacgccatattcatgacaacg
atactcgtccaccggtgctatcgagatgagcagcgatgcgccaggaaatatgggaagacc
tgggaggaatactgtgagaaagtccgatggagaatcattcctggcgtcttttag

DBGET integrated database retrieval system