KEGG   Ajellomyces capsulatus: HCAG_02739Help
Entry
HCAG_02739        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
aje  Ajellomyces capsulatus
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    HCAG_02739
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     HCAG_02739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 417 aa AA seqDB search
MLACPAAIIFWYVTLHHFDGSLLSASVALRNKGFISFYREYCPVLNLRATLVYGAWVLFQ
ALLYSFLPGSTYEGQPTPAGNILKYKINGLLAVVVTVLLFGAISLRGGILASSFVATNWG
AFLAIFNIYGLFLALAFYLKAHFAPSHPEDRKFSGSPIYDLYMGIELNPRLGQSWDMKLF
HNGRPGIIGWILIDMSFTALQFLRHGYITSSIITADILHLVYIIDFFFNEHWYLKTLDMA
HDHVGFYLAWGSAAWLPTIYTLQPQFLAIHPVSLSPIAAATILTTGLGGYILFRSANDQK
YLVRETQGKCLIWGKAPKYIQCKYKTTDGSTHKSIILCSGWWGVVRHANYLGDLVLSYAM
CATCGFTHLLPWTYAIFMTTILVHRCYRDEQRCARKYGKTWEEYCEKVRWRIIPGVF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctggcatgccctgctgccattatcttctggtatgtgacgctacaccattttgatggc
tcattattgtcagcctccgtggcgctcaggaacaaggggttcatttccttttatcgcgaa
tactgccccgtccttaatctgagagctactcttgtctacggagcttgggttctttttcaa
gcgctactgtacagttttctcccagggtctacgtatgaaggacagcccacccctgctgga
aatatcctcaagtacaaaatcaacgggttgttggctgtcgttgtcactgtgctcctgttt
ggcgcgataagtctgcggggtggtattcttgcttcatcatttgtcgccacaaattggggt
gcatttctcgccatattcaatatttacggcttgtttctcgctctagctttctaccttaaa
gcccactttgcgccatcacatccagaagacagaaagttcagcgggtctcccatctacgac
ttgtatatgggaatcgagctcaacccgcggttgggccaatcatgggacatgaaacttttc
cacaatggccgtcctggtattattggttggatattaattgacatgtccttcaccgcgctc
cagtttttacggcacggatacattacgagctcaattattactgccgacatccttcacctg
gtttatattatagactttttcttcaatgagcattggtacctcaaaaccctcgatatggct
catgaccatgtcggattttatttagcttggggctcggcagcctggcttcccaccatctac
accttgcagccccaatttctagcaattcacccagtgtctctctctcctattgctgcagct
acgattctgaccactgggcttggtggatatattctgttccggtccgcaaatgaccagaaa
tacctcgtgcgtgaaacccagggcaaatgtttaatatgggggaaggcgccaaagtatatc
caatgcaagtataagaccacagatggatcgacgcacaaatctattattctatgttccgga
tggtggggagttgtccgtcatgcgaactacttgggtgatctcgtcttgtcctacgcaatg
tgtgctacctgcgggttcactcacttgctcccgtggacatacgccatattcatgacaacg
atactcgtccaccggtgctatcgagatgagcagcgatgcgccaggaaatatgggaagacc
tgggaggaatactgtgagaaagtccgatggagaatcattcctggcgtcttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system