KEGG   Ajellomyces capsulatus: HCAG_02903Help
Entry
HCAG_02903        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
aje  Ajellomyces capsulatus
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    HCAG_02903
  Replication and repair
   03420 Nucleotide excision repair
    HCAG_02903
Transcription machinery [BR:aje03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     HCAG_02903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 491 aa AA seqDB search
MLEDEIYRTSSQYRLWSFTKESLCLIRANSNTVASERVKDAIRRAKNDARSQQPAATGAR
SSSGTPNATGDADDGKTAEATIGSGEQTTEKEKDKEIECLTVEEELELVRYYCEKTMELG
DEYKPPLPTVVRATAIQYLRRFYLTNSPMTYHPKSIMPCALFLATKTENYYMSLRSFAEH
IPNATPEDIIAPEFLLTQGLRFTFDVRHPFRSLEGGIMELNAIARGDGAPGPHHPEQTAA
GLQQAIQSLPPPPPLTLAAAEYPDQKKPGGSGSITSRIAKAHHNTREILRSAAQLTDVYF
LYTPSQIWLSAFLLADRPIAEFYIDTKLIPLPSTTSQSQSQSQSQPSKDVFSVLRTKLSL
ILNSCSTILSTYQTNHMPSTAPATMKNLKRIGRKLYHCQNPEKIDLRNLNRAAKREGSSA
AAVKGTGTGTGTPAAAAEVGAGAGAAGDDDEAELQRAAKKRKLERERFQQEGARLFGGDL
VEHRKKKAETD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagacgagatctaccgaacatcatcgcagtatcgcctctggtccttcaccaaa
gaatccctctgcttaatacgggccaattccaataccgttgccagcgaacgtgttaaagat
gcgatacggcgtgctaaaaatgatgcgcgatcgcagcagcccgcagccacaggtgctaga
tccagtagcggtaccccaaacgcgaccggtgatgctgatgatggaaaaactgcagaggcg
acgataggcagtggtgagcagacaacagagaaggagaaggataaggagattgaatgcttg
acggtggaggaggagctggagttggtgaggtattattgcgagaagacgatggagttgggc
gatgagtataagccgccgttgccgacggttgttagggctactgcgatccaatacctccgc
cgcttctaccttaccaactcccccatgacctatcaccccaagtccattatgccctgcgct
ctcttcctcgctacaaagacagaaaactactacatgtccctacgctcatttgcagaacac
atcccaaacgctacgccggaggatatcatcgcgcccgaatttctccttacacagggactt
cgctttacctttgacgtccgccacccgttccgcagcttagaaggtggaatcatggaacta
aacgccattgcgcgaggggatggcgctccgggcccacaccaccctgagcaaacagcagcc
ggtctgcaacaggcaatccaatcgcttccgccgccgcctcctcttaccctggcggcggcg
gaatatccagaccagaagaaaccaggtggtagtgggtccattacctcccgcatcgccaag
gcacatcataacactcgcgaaatcctccggtccgcagcacaattgacggatgtatatttt
ctctacacaccatctcaaatatggctctccgctttcctcctggccgataggccgatcgcg
gaattctacatcgacacaaaactcatcccattaccgtccaccacctcacaatcacaatcg
caatcacaatcacagccctcaaaagacgtcttctcagtcctccgcaccaaactctccctc
atcctcaattcctgctccacgatcctctccacctaccagacgaaccatatgccatcaacc
gcacccgccactatgaaaaacctcaaacgcatcggcagaaaactataccactgccagaat
ccggagaagattgacttgcgaaatttaaaccgcgccgcgaagcgtgagggttcctctgct
gctgccgtgaaaggaactgggactgggacagggacacctgctgccgcagctgaagttggc
gctggcgctggtgctgcaggtgatgatgatgaagcggaactgcagcgagcggcgaagaag
cggaagctggagagggagagatttcagcaggaaggggcgaggcttttcgggggagatttg
gtggaacataggaagaaaaaggcggaaacggattga

DBGET integrated database retrieval system