KEGG   Ajellomyces capsulatus: HCAG_03173Help
Entry
HCAG_03173        CDS       T02229                                 

Definition
ubiquitin C-terminal hydrolase
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     HCAG_03173
Peptidases [BR:aje01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   HCAG_03173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 593 aa AA seqDB search
MATIPGELRFSVFHLGFNFRASTNQWTQVIVKHQGKRHEVDLDPTANGETFKFQLYSLTG
VEPERQKVLVKGGQLKDDTELSALNAKPGQTFMMLGTPSASNISAALEKPKETTKFIEDM
TEAEAARADGATPAGLQNLGNTCYLNSTLQTLRTIPELHEELLKYQPSAGSSNSRSMLGI
PSSGDLTASLKDLYKRMSETQEGFPPISFLNSLRHAFPQFAQRAKEGPGYAQQDAEEAWS
QIISQLRQDLKTKGENGDESSEIAFVDKYLAGRLESILECDDPAAKEAGETAIETSDSFL
KLDCHIDKNINHLRDGLLAGLEEKIEKNSPTLNRDATYTKRSKISRLPKYLTVHFVRFFW
KRDKQKKVKIMRRVTFPQELDVVEFCTEELKEKLFPVRDKVREIRKDERDMERVRKRQKI
AHKREEEQKANTSMVEPIQKKQIATEDPDATTDVPMEEAFKTDAEYESERAAAVMAAKKE
LFNLIDPKLASDDGANTSGLYELCGVITHQGPSAESGHYTSYVKKQGRIVDDPLAPGGKR
YEDDGKWWWFNDDKVSEVEAEKIETLSGGGESHSALILLYRAIDLPTAEEVKG
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggctacgatacctggtgagcttcggttttctgttttccaccttggttttaactttcgt
gcttctactaatcagtggactcaagtaattgtcaaacaccaaggcaagcgccacgaggtc
gatctcgatccgactgccaatggagaaaccttcaaattccagctctattcgctgactgga
gtcgagccagaacgccagaaggttctcgtgaagggtgggcagctgaaagatgacacagaa
ctctcagcccttaatgcaaagcctgggcaaacattcatgatgctgggaacaccaagcgct
agcaatatttccgcagctctagagaagcctaaagagacgacaaaattcattgaggatatg
acggaagccgaagctgcgagagctgatggcgcgacccctgccggtctacaaaatttgggt
aatacatgctacctaaactcgacactacagacgttgcgaaccattccagagctgcatgaa
gagcttctgaaatatcagccttcagccggttcatcaaattcgcgtagtatgctaggaatt
ccttcttctggggacctgaccgcttctctgaaggatctttataagcgcatgtctgaaacg
caggaaggatttccacctatatcttttctgaactctctgaggcatgctttcccgcagttt
gcacagagagcgaaggaaggtcccgggtatgcacagcaagacgcagaagaggcatggtcc
cagatcatatctcaactacgccaggatctcaaaactaagggcgagaacggtgatgaatcg
tccgagatagcttttgtcgacaagtacctcgctgggagactcgagtcgatccttgaatgt
gatgaccctgcggcgaaagaagcaggtgagaccgctattgaaacttcagactccttcctt
aagctagactgtcatatcgacaaaaacataaaccatttgcgggacggcctgttggcgggc
ttggaggaaaaaattgagaagaactcgcctactctgaaccgggacgcgacttatacaaaa
cgctctaagatctctcgattaccaaaataccttacagtgcattttgttcgatttttttgg
aaacgagataaacagaagaaggtgaaaatcatgcgcagagtgacattcccacaagagctg
gacgttgtggaattttgcactgaggagctgaaggaaaagcttttccctgtcagagacaag
gtccgcgaaattcgcaaagatgaacgtgatatggaacgagttcgtaagcgtcagaagatc
gcacataaacgggaagaggagcagaaggctaatacctccatggtcgagcctatccaaaaa
aaacaaatcgccaccgaggaccctgatgcgaccaccgatgttcctatggaggaagccttc
aaaactgatgctgagtacgaatccgagcgtgccgcagccgttatggctgctaaaaaagaa
ttgttcaatctcatcgacccaaaactcgcgtctgatgatggcgccaatacatccgggctg
tacgaattgtgcggagtcattacccaccaggggcctagtgctgagagcggccactacacc
tcttacgtgaaaaagcaaggaaggattgtcgatgaccctctcgctcccggcggcaagaga
tacgaggatgatggcaaatggtggtggttcaacgatgacaaagtttctgaggttgaggcg
gagaagatcgaaactctgtcaggcggtggtgaatcgcattctgcactgatactgctttat
cgggctatcgatttgccaaccgcagaggaagttaaaggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system