KEGG   Ajellomyces capsulatus: HCAG_03286Help
Entry
HCAG_03286        CDS       T02229                                 

Definition
similar to eukaryotic translation initiation factor 3
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
aje  Ajellomyces capsulatus
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:aje03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 737 aa AA seqDB search
MAPSFDTLSEQDLHEQELDIDFSDLKAQYEVRLEEGLDAFVVIDGLPIVPEESKPRLVKF
LLKKLNTVGRTSEDAIFMPMNENKMSEGFAFVEYESPEQALEATKHLHGTPLDKKHTLAV
NKLTDIDRYGREGRVDEEYKPPTIEPFQEKEHLRSWLGDPNARDQFAMFRGDKVGVFWNM
KKDPPENIVDRDHWTQLFVQWSPQGTFLASVHPQGVQLWGGPQFTKQKQFPHPFVQLIEF
SPGESYLTTWSARPIQIEGPHPVLSYEEDGKHFIIWDITTGKPLRSFVNHDVPASAGPEG
ESVKKKVQWPAFKWSSDEKYVARMLLGQSISVYELPRMNLLDKTSIKIEGVTDFEWAPAA
PQRDGIKQYEQLFSFWTPEIGSNPAKVGLMSIPSKEIVRTRNLFNVSDVKLHWQSQGAYV
CVKVDRHSKSKKSLATNLEIFRVKEKGVPVEVVDSIKDTVINFAWEPKGDRFVLITTGEA
TPGAAVAPKTAVSFFCPEKVKGTGTGNFKLIRTIEKKTSNGIYWSPKGRFVVVATVHSQQ
NFDLDFWDLDFEGEKQESEKDLSANLQLMKTSDHYGVTDIDWDPTGRYVVSSASAWTHTM
ENGYNIHTFAGTTLAEHPTEKFKQFVWRPRPPTFLSKEEQKQVRKNLREYSREFEEEDKY
AVDIANTAIVEMRKRVLKEWTAWVRREKELLDEEIEMLGLEKEDDMDAAAKEETEAEGMV
VEEIVEEIIDETEEIIG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgagtttcgacactctttcagagcaggacctccacgagcaggagctggatatc
gatttttcagaccttaaagcacaatatgaagttagactggaggagggcttggatgccttt
gtggttatcgatgggctgccaatcgtgcccgaagagagcaaaccgcggcttgtgaaattc
ttgctgaaaaagctgaacactgttggccggacgagcgaagatgccatttttatgcccatg
aacgagaataagatgtcggaaggatttgcatttgttgaatacgagtcacccgaacaggct
ctcgaggccacgaaacatcttcacggcactcccctggataaaaagcacacattggctgtt
aataaacttacggatatcgatcggtatggacgtgagggccgtgttgacgaggaatataaa
ccaccgaccatcgagccattccaagaaaaggaacaccttcgatcgtggctaggcgacccc
aatgcccgcgaccagtttgcaatgttccgaggcgacaaggttggtgtgttctggaatatg
aaaaaagaccctccagagaatatcgtcgaccgggatcactggacccagcttttcgtacaa
tggtctccacaaggcactttcctcgcgtctgtgcatccacaaggtgtgcagctttgggga
ggaccccaattcaccaagcaaaaacaattcccccatccattcgttcagcttattgagttt
tcccccggtgaaagttacttgacaacctggtcagcacggccgatccaaatcgaaggcccc
cacccggttctctcctacgaagaggacggcaaacatttcattatctgggacatcacaact
ggcaagccgctgcgatcatttgtcaaccatgacgttcccgcgtctgctggcccagaggga
gagtctgtgaagaagaaggtccaatggcctgccttcaagtggtcttcggatgaaaaatac
gttgcacgaatgctcctaggccaatccatttctgtctacgagcttccacgcatgaacctc
ctagataagacatctattaaaatcgaaggagttactgatttcgaatgggcgcccgcggca
ccccaacgcgacggcattaaacaatacgaacaactattctccttctggaccccagaaatc
ggcagcaaccccgcgaaagtcggtttgatgagcatcccttccaaggaaattgtccggaca
agaaatctcttcaacgtttccgacgttaaactccattggcaatcgcagggtgcatacgtc
tgcgtcaaagttgaccggcactccaagtccaagaagtctcttgctacaaatctcgaaatt
ttccgtgttaaggagaaaggcgtccctgttgaggtggttgactctatcaaagataccgtg
ataaacttcgcttgggagcccaagggcgatcggttcgttctcatcacgaccggcgaagcc
acccctggcgccgcagttgctcccaagacagccgtttcgttcttctgccctgagaaagtc
aagggcaccggtacgggaaatttcaaacttatccgtaccatcgagaagaagacgagcaac
ggcatatattggtctcctaagggccggttcgtggttgtagccactgtccactcgcaacag
aacttcgacctcgatttctgggacctggacttcgagggtgagaagcaggagagcgagaag
gacctttccgcaaatctccaactaatgaaaacctccgatcactacggtgtcactgacatc
gactgggacccgactggccgttacgttgtcagcagtgccagtgcttggactcacacaatg
gaaaacgggtacaacatccacacgttcgccggcaccacactcgccgaacacccaacagag
aaattcaagcagttcgtctggcgcccgcgtcccccgaccttcctcagcaaggaggagcag
aaacaggtccgcaagaacctgcgcgagtactcccgagagttcgaagaggaggacaagtac
gccgtcgacattgccaacacggctattgtcgagatgcgcaagagagtccttaaggaatgg
actgcttgggtacgccgggaaaaggagctgctggatgaggagattgagatgcttggcctg
gagaaggaggatgatatggatgcagcggctaaggaagagacggaggcggagggaatggtg
gtggaggagattgtggaggagatcattgacgagacggaggagattattggatga

DBGET integrated database retrieval system