KEGG   Ajellomyces capsulatus: HCAG_03447Help
Entry
HCAG_03447        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
aje  Ajellomyces capsulatus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aje00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 747 aa AA seqDB search
MRGDDVSTSFQHHWLSRGEKKFLHLGNRKISHMRLTSTMCGITASIALPLSRGSGTASGS
THPTVESLTCKLQASLEKIKHRGPDGSGVWVNVDGSVGLGHCRLSINDLTPSGAQPLSSD
DGQIHAIVNGEIYDFDRLRDICATTHGYKFHGQSDSELVLALYKIYGCPEFFKHLRGEFA
FVLYDSREGCEKVIAVRDRFGIKPLYWMTVGDRILLAAESKAFLPLGWKPEWDVASIVES
GWSVDDRTYFKGVKKVPPGHWLEISKTGVEIHQYWDSAYVDKTKPDARSIDEMVIQVRER
LVEAVRLRLRADVPVGVYLSGGIDSSSIAGIATHLAKQDQVKIGSQAATRVACFSVEFPK
KSGYDESDVADRTAKWLGVESIKKVADEATLAENFTDAAYHCEHHNSDLNFVAKFALSSL
PQENGVKVVLTGEGADEHFAGYTYFPQDLLLEPDQTQPDSVLSSGELHQQLQKKVFDEIN
AIFRMFGVPIHGGNGDDEFLSDANGCTMPRIISMMAQPSAEIYSSWTRDGNHAYDIRKTV
MASHSREVRAKMRSTWHPLHTSLYMWNKSGLPNIIIPGLGDRVEMAHSVEGRTPFLDHIL
TEYVDGLPPSVKIAYTPKQATAALQNGELWDHAGSVLQSMTEKWILREAVRPYITDEVYR
MKKRPFMAPVTWPKKGPLHCLFEKLLTRDAVENLGFVDYSVVERALGRAFGDNADRMAFR
TLVCAGSWVALSQRLGVKRAEEADYIR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcggggagacgatgtttcaacaagtttccagcaccattggctcagccggggtgaaaag
aaattcctccacttgggaaacagaaagatctcacacatgcgcctcacatccacaatgtgc
ggcattacggcaagtattgccctgcctctaagccgtgggtcaggaactgctagtggtagc
acccaccccactgttgagtctctgacttgcaaacttcaagcatcgcttgagaaaataaaa
caccgtggaccggatggctctggcgtttgggtcaacgtggatggcagcgttggacttggt
cattgccgactttccatcaacgacctgacccccagcggcgcgcaaccgctatccagcgat
gatgggcaaatccacgccattgtcaacggcgagatctacgactttgaccgtctacgggac
atatgcgccacaactcacggctataaattccatggtcaaagcgacagcgaactcgtccta
gctctctacaaaatctacggctgtccggagtttttcaaacacctacggggtgaatttgca
tttgtgctctacgacagccgcgagggatgcgaaaaggtgattgctgtgagagataggttt
ggaattaaaccactgtattggatgactgttggtgatagaatactgctggcagcggagtca
aaagcgttcttgccgttaggctggaagcccgaatgggatgttgcgtccattgtcgagagc
ggttggagtgttgacgacagaacatatttcaaaggtgtcaaaaaggtaccaccgggacat
tggcttgaaatatccaaaacgggggttgaaatacatcaatactgggattcagcctatgta
gacaagaccaaacctgacgcgcggagcattgatgaaatggtaattcaagtccgcgagcgg
ctggttgaggcggtccggctgcgacttcgcgcggacgttcctgttggcgtatatctatca
ggcggtatcgactcttcttctattgcaggaatcgcaacgcatcttgcgaaacaagaccag
gtcaaaatcggcagccaagcagcaacgagagtggcgtgctttagcgtggagtttccaaaa
aagtcgggctatgatgagtcggatgtcgctgatcggacagccaaatggttgggggttgaa
tctattaagaaggtcgctgacgaagccaccctagcggaaaactttactgacgcggcatac
cattgtgaacaccacaacagcgatctcaactttgtcgcgaagtttgcattatcgtcgctt
ccacaggagaatggggtcaaggttgtcctcacaggtgagggggctgacgaacacttcgcg
ggatacacctactttccgcaggacctcctgctggaaccggaccaaactcaaccagactca
gtactctcatcgggtgagctccaccagcagctgcaaaagaaagtctttgacgagataaac
gctattttccgcatgtttggggtccccattcacggaggaaacggagatgatgaatttctt
tccgacgccaacggctgcacaatgcctaggataatatcgatgatggcacaaccatccgca
gagatttactcatcatggacacgcgacggtaaccatgcgtacgatatcaggaagacggta
atggcatcgcattcacgtgaagtccgggccaagatgcgctcaacatggcatccgctgcac
acatccctttacatgtggaataaaagcggcctacccaatattatcatcccaggtttggga
gaccgcgtcgaaatggcccacagtgttgagggacgcacaccattcctggatcatatcctc
actgagtacgtggacggtcttcccccaagtgtcaaaatcgcctatacccccaaacaagcg
acggcggctctccagaacggcgaactttgggaccatgccggttcggtcctgcaatcaatg
acagagaaatggatcttgcgtgaggcggttcggccgtacattacggacgaggtataccga
atgaagaaacgaccgtttatggcgcctgtaacctggcccaaaaaggggcccctgcactgc
ttatttgaaaagctattgactcgtgatgctgttgaaaacctgggctttgtcgattacagt
gtagtcgaacgggccctaggtcgagcattcggtgataacgcagatagaatggcgttccgt
acattggtgtgtgctggttcgtgggttgctctttcacaacggctgggtgtcaaaagggca
gaggaggcggattatattcgttga

DBGET integrated database retrieval system