KEGG   Ajellomyces capsulatus: HCAG_03461Help
Entry
HCAG_03461        CDS       T02229                                 

Definition
protein kinase byr1
Organism
aje  Ajellomyces capsulatus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 541 aa AA seqDB search
MGDSFKARTLKRKNVKGLALNSAGPKTGSNTSDGDAQIPGGFGNQDGNRTDTLEIGLEFK
LDLRSEDLVVLKELGAGNGGTVSKVMHASTKVIMARKVCSLLFSPVSASIVRELQVGHDC
NSPYIVTVYGAFQNEARDIVLCMEYMDCGSLDRISKDFGPVRVDVLGKIAESILAGLVYL
YEVHRIMHRDIKPSNVLINSRGNIKLCDFGVATETVNSIADTFVGTSTYMAPERIQGGVY
TVRSDVWSVGLTVMELAVGRFPFDATDSAAGDRASAGPMGILDLLQQIVHEPAPKLPKSD
AFPPILDEFVAKCLLKKPEERPTPRELYDKDAFLQAAKRTPVNLREWAISMMEQHNRKSY
LAPPAPKAITRDGSRDSISHSRNAEASPRARYTPTSGEIPLNITREPTSNNSSAAQMYGD
PMSAIEPSSTMGFEHLSLGSATHHHPDYNHNPLQHLTSNGNGHSNSSSSIPHPSRQYPSH
PHIDTSVPQYTSPMSASATTARAPIQSATLPSRPAPPPSGPLPAPPGSAGPGGWRTQSHR
V
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggagactccttcaaggcgcggacactgaagcgaaagaatgtgaaggggctagctctc
aattctgcggggccaaagactggctccaacacttcagatggcgatgctcagataccaggt
ggcttcggcaatcaagacggtaaccggacagacacactagagatcggactggagtttaag
ctcgatttaaggagtgaggacctggtggtgctgaaggagctcggggcgggcaatggaggg
acggtcagcaaggtgatgcatgcgtcgacaaaagtcattatggctcggaaagtgtgttct
ttactgttttctcccgtttctgcttcgattgtgagagagttacaggtcggccatgattgc
aattcgccatacattgttacggtctacggcgctttccaaaatgaagccagggatattgta
ctctgtatggagtatatggattgcggttcccttgaccgtatctccaaagactttggcccc
gtccgtgtcgatgtcctcgggaaaatcgcagaatctatcctcgcaggccttgtataccta
tacgaagtccaccgcatcatgcacagagatatcaagccctccaacgtcctaataaattcg
agaggaaatataaagctttgcgattttggcgtggctaccgaaactgtcaactcgatagcg
gacacttttgtcggcacatcgacatacatggctcccgagcgtattcagggcggggtatat
accgtacgctcggatgtgtggagtgttggtttgaccgtaatggaactggctgtgggccgc
tttccctttgatgcaaccgactcggctgcgggtgatcgcgcaagtgcggggccaatggga
attctggatctgttacagcaaatcgtgcatgaacccgcaccaaagttgcccaagagcgat
gcattcccgccaatcttggatgagttcgttgccaagtgtttgctcaagaaacccgaggaa
cgtccaacgccacgggagctctatgacaaagatgctttcctccaagctgccaaacgaacc
ccagtaaatctccgcgaatgggcaatcagcatgatggaacagcacaacaggaaatcatac
ctcgcaccaccagccccgaaagcaatcacgcgagacggctcgagggattccatctcccac
tccagaaacgcagaagcgtcccctcgagcccgctacacacccacgtccggagaaatcccc
ctgaacattacccgggaacctaccagtaacaacagcagtgccgcgcagatgtacggcgac
ccaatgtccgccattgaaccctcgtcaacaatgggcttcgagcatctctcgctcgggagc
gcaacccaccaccatccagactacaaccacaacccccttcagcatttaacctcaaacggc
aacggacacagcaacagcagcagcagcattcctcacccgtcgcggcaataccccagccat
ccgcacatcgacacctccgtcccacagtatacatcccccatgtcggcgtctgccacgacc
gcgcgagcccccatacaatctgcgactttgccgtcaaggccggcaccgcctccttccggc
ccgcttcctgcacctcctggctccgcgggaccaggcggttggcggacgcagagccatcga
gtatga

DBGET integrated database retrieval system