KEGG   Ajellomyces capsulatus: HCAG_03522Help
Entry
HCAG_03522        CDS       T02229                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aje  Ajellomyces capsulatus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCAG_03522
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCAG_03522
  Amino acid metabolism
   00310 Lysine degradation
    HCAG_03522
Enzymes [BR:aje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HCAG_03522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 452 aa AA seqDB search
MSKHLRLVPRHVYTSSISCRAVSSLSRASRSNGSLRTAHTTLLNSSVPWRQSVALSNNPL
FMGSQRRTYADSIVKVPPMAESISEGTLKQFSKKVGEYVERDEELATIETDKIDVTVNAP
EAGTIKELFVNEEDTVTVGQDLVRLETGGPAPEKSKEEKEPAKAEEKPAAKTESAHPPPS
SSPKEGAKATTPPPKSEPIVQKSSPSKPEPAQASQSALGNREERRVLSPPLKKKLFRLTC
YLAASLTTFNEVDMSSLMEFRKLYKDDILKKTGVKLGFMSAFSRACVLAMRDIPTVNASI
EGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAESMELIGIEKAIAELGKKARDNKLT
IEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDKPVVVNGKIEIRPMMYLAL
TYDHRLLDGREAVTFLVKIKEYIEDPRRMLLA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacatttgcgacttgtccctcgacatgtttataccagctcaatctcttgcaga
gctgtgtcttctctaagccgggcgtctcgatccaatggcagcctgagaactgcgcacacc
actcttctgaattcgtcggttccatggagacaatctgtagccctgtcgaataacccgctg
tttatgggcagccagcgacgaacttatgcggattcgatcgtaaaggtaccgccgatggcc
gagtcgatatcagaaggaacattaaaacagttttctaaaaaggttggcgaatatgttgag
cgagacgaggaacttgcaaccatcgaaacagataagatcgatgtcaccgtcaatgctcca
gaggcaggtacgatcaaggaactttttgtaaatgaggaggacactgttaccgttggtcaa
gatctcgtcaggctggagacagggggccccgctcccgagaagtccaaagaagaaaaggag
cctgcgaaagcggaagaaaagccagcagccaaaacagaatctgctcacccgccaccgtca
tcgtctccgaaagaaggagcaaaggccactacccctccaccaaagtcggagccaatcgtc
cagaaatcctccccatccaaaccggagccggcccaagcgtctcaatcagcccttgggaat
agggaagaacgcagagtactctcccctccactgaagaaaaagctctttcggctgacatgt
tatctagcggcatcgctcactacattcaacgaggtcgacatgtcatctctcatggaattc
cgtaaactatacaaggacgatattttgaagaaaactggtgtaaaattgggctttatgagc
gcgttctctcgtgcctgtgttttggctatgagagatattccaaccgtcaatgcgtctatt
gaagggcccaatggcggagatacaatcgtctatagagactatgtcgatatcagcgtggcg
gtagcgacggagaagggtctagtcacgccggtcgtacgaaacgctgagtctatggaactc
attgggattgagaaggcgattgcggaattaggtaaaaaggcacgtgataataaattgacc
attgaggatatggccggcggcacgttcaccattagcaatggaggcgtttttggatctctg
atgggtaccccgattatcaaccttccacaaacagctgtgctcggccttcacgcgatcaag
gataagccagtcgtcgtcaatggaaaaattgagatcagacctatgatgtatctcgcattg
acctacgatcaccgtcttctggatggtcgggaagccgtcacgttcttggttaagattaag
gagtatatcgaagatccgaggcgaatgcttctggcataa

DBGET integrated database retrieval system