KEGG   Histoplasma capsulatum: HCAG_03522Help
Entry
HCAG_03522        CDS       T02229                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aje  Histoplasma capsulatum
Pathway
aje00020  Citrate cycle (TCA cycle)
aje00310  Lysine degradation
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01200  Carbon metabolism
Module
aje_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aje_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCAG_03522
  Amino acid metabolism
   00310 Lysine degradation
    HCAG_03522
Enzymes [BR:aje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HCAG_03522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H HlyD_D23 Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 5448108
NCBI-ProteinID: XP_001541424
UniProt: A6R1L4
AA seq 452 aa AA seqDB search
MSKHLRLVPRHVYTSSISCRAVSSLSRASRSNGSLRTAHTTLLNSSVPWRQSVALSNNPL
FMGSQRRTYADSIVKVPPMAESISEGTLKQFSKKVGEYVERDEELATIETDKIDVTVNAP
EAGTIKELFVNEEDTVTVGQDLVRLETGGPAPEKSKEEKEPAKAEEKPAAKTESAHPPPS
SSPKEGAKATTPPPKSEPIVQKSSPSKPEPAQASQSALGNREERRVLSPPLKKKLFRLTC
YLAASLTTFNEVDMSSLMEFRKLYKDDILKKTGVKLGFMSAFSRACVLAMRDIPTVNASI
EGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAESMELIGIEKAIAELGKKARDNKLT
IEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDKPVVVNGKIEIRPMMYLAL
TYDHRLLDGREAVTFLVKIKEYIEDPRRMLLA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacatttgcgacttgtccctcgacatgtttataccagctcaatctcttgcaga
gctgtgtcttctctaagccgggcgtctcgatccaatggcagcctgagaactgcgcacacc
actcttctgaattcgtcggttccatggagacaatctgtagccctgtcgaataacccgctg
tttatgggcagccagcgacgaacttatgcggattcgatcgtaaaggtaccgccgatggcc
gagtcgatatcagaaggaacattaaaacagttttctaaaaaggttggcgaatatgttgag
cgagacgaggaacttgcaaccatcgaaacagataagatcgatgtcaccgtcaatgctcca
gaggcaggtacgatcaaggaactttttgtaaatgaggaggacactgttaccgttggtcaa
gatctcgtcaggctggagacagggggccccgctcccgagaagtccaaagaagaaaaggag
cctgcgaaagcggaagaaaagccagcagccaaaacagaatctgctcacccgccaccgtca
tcgtctccgaaagaaggagcaaaggccactacccctccaccaaagtcggagccaatcgtc
cagaaatcctccccatccaaaccggagccggcccaagcgtctcaatcagcccttgggaat
agggaagaacgcagagtactctcccctccactgaagaaaaagctctttcggctgacatgt
tatctagcggcatcgctcactacattcaacgaggtcgacatgtcatctctcatggaattc
cgtaaactatacaaggacgatattttgaagaaaactggtgtaaaattgggctttatgagc
gcgttctctcgtgcctgtgttttggctatgagagatattccaaccgtcaatgcgtctatt
gaagggcccaatggcggagatacaatcgtctatagagactatgtcgatatcagcgtggcg
gtagcgacggagaagggtctagtcacgccggtcgtacgaaacgctgagtctatggaactc
attgggattgagaaggcgattgcggaattaggtaaaaaggcacgtgataataaattgacc
attgaggatatggccggcggcacgttcaccattagcaatggaggcgtttttggatctctg
atgggtaccccgattatcaaccttccacaaacagctgtgctcggccttcacgcgatcaag
gataagccagtcgtcgtcaatggaaaaattgagatcagacctatgatgtatctcgcattg
acctacgatcaccgtcttctggatggtcgggaagccgtcacgttcttggttaagattaag
gagtatatcgaagatccgaggcgaatgcttctggcataa

DBGET integrated database retrieval system