KEGG   Histoplasma capsulatum: HCAG_03525Help
Entry
HCAG_03525        CDS       T02229                                 

Definition
(RefSeq) histone H2b
  KO
K11252  
histone H2B
Organism
aje  Histoplasma capsulatum
Brite
Chromosome [BR:aje03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    HCAG_03525
Exosome [BR:aje04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HCAG_03525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 138 aa AA seqDB search
MPPKAAEKKPSTAGKAPAGKAPEKKEAGKKTTAAGGEKKKRSKTRKETYSSYIYKVLKQV
HPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAK
HAVSEGTKAVTKYSSSAK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaaggccgctgagaagaagccctccactgctggcaaagccccagctggcaaa
gctcctgagaagaaggaggccggcaaaaagaccactgctgctggtggtgagaagaaaaag
cgatccaagaccagaaaagagacctactcctcctacatctacaaagtcctcaagcaagtc
cacccagatactggtatctcaaaccgcgccatgtccatcctcaattctttcgtcaatgat
atctttgagcgtgtcgccactgaagcctccaagcttgctgcatacaacaagaaatccacc
atttcttcccgagaaattcagacttccgtgagactcatcctgccaggtgaacttgccaag
catgccgtctctgaaggcacaaaggctgtcaccaagtactcctcgtccgccaaataa

DBGET integrated database retrieval system