KEGG   Ajellomyces capsulatus: HCAG_03525Help
Entry
HCAG_03525        CDS       T02229                                 

Definition
histone H2b
Orthology
K11252  
histone H2B
Organism
aje  Ajellomyces capsulatus
Brite
Exosome [BR:aje04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HCAG_03525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 138 aa AA seqDB search
MPPKAAEKKPSTAGKAPAGKAPEKKEAGKKTTAAGGEKKKRSKTRKETYSSYIYKVLKQV
HPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAK
HAVSEGTKAVTKYSSSAK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaaggccgctgagaagaagccctccactgctggcaaagccccagctggcaaa
gctcctgagaagaaggaggccggcaaaaagaccactgctgctggtggtgagaagaaaaag
cgatccaagaccagaaaagagacctactcctcctacatctacaaagtcctcaagcaagtc
cacccagatactggtatctcaaaccgcgccatgtccatcctcaattctttcgtcaatgat
atctttgagcgtgtcgccactgaagcctccaagcttgctgcatacaacaagaaatccacc
atttcttcccgagaaattcagacttccgtgagactcatcctgccaggtgaacttgccaag
catgccgtctctgaaggcacaaaggctgtcaccaagtactcctcgtccgccaaataa

DBGET integrated database retrieval system