KEGG   Ajellomyces capsulatus: HCAG_03865Help
Entry
HCAG_03865        CDS       T02229                                 

Definition
similar to NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
aje  Ajellomyces capsulatus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aje00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 310 aa AA seqDB search
MAMFSWTSSEAINGMYIPSALLIFGTAIVKKEWLPYAVALAAILSGGKVFSNRQRKVLNP
TEFQNFELKEKTIVSHNVAIYRFALPRPTDILGLPIGQHISLAATIEGQTKEIMRSYTPI
SSDQEAGYFDLLVKAYPQGNISKHLAGLRIGQTMKVRGPKGAMVYTPNMVKKIGMIAGGT
GITPMLQIIKAIIRGRPRNGGNDTTQVDLIFANVNPDDILLKDELDQLAKEDDGFRVFYV
LNNPPEGWEGGVGFVTPDMIRAKLPAAAPDTKVLICGPPPMVSAMKKATESLGFKKAGLV
SKLEDQVFCF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgttttcctggacttcaagcgaagcgatcaacggcatgtatatcccgtccgct
ctcctgattttcggtactgccattgtgaagaaggaatggcttccctacgcagtagctctc
gccgcgattttgtctggggggaaagtgtttagcaacagacaacggaaggttctcaatccc
accgaattccaaaactttgaattgaaagagaaaaccatcgtctctcacaatgtcgccatt
taccgcttcgccctcccgcgccctacagatatccttggtttacccattggtcaacatatt
tctctcgctgcaactatcgagggccagacaaaggaaatcatgcgatcttatacccctatc
tcttcggaccaggaagcaggctatttcgaccttcttgtcaaggcatatcctcaaggaaac
atctcgaaacatcttgctggcttgcgcattggccaaactatgaaggttcgaggtccgaaa
ggagctatggtttatacccccaacatggttaaaaaaattggtatgatcgctggcggcacc
ggaattacgccaatgctccaaatcattaaagctattatccgaggaaggccgcggaacgga
ggcaacgacaccacccaggttgatctgatatttgccaacgtcaacccggatgacatcctc
ctaaaagatgaactggaccagttggcgaaggaggatgatggattccgagttttctatgta
ttaaacaacccaccagaaggctgggaaggtggcgttggcttcgttactccagatatgatc
agggccaaactcccggctgccgcgcccgatacaaaggtcttgatctgcggaccacctccc
atggttagcgccatgaagaaagcaactgagtccctgggattcaagaaggctggactcgtt
agcaaactagaggaccaggtattttgcttttag

DBGET integrated database retrieval system