KEGG   Ajellomyces capsulatus: HCAG_03889Help
Entry
HCAG_03889        CDS       T02229                                 

Definition
cAMP-dependent protein kinase type 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aje  Ajellomyces capsulatus
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:aje00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    HCAG_03889
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     HCAG_03889
Protein kinases [BR:aje01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   HCAG_03889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 368 aa AA seqDB search
MHRSHNNSSNSNHHHNSSSKNNNNIIISTIIIIIIIAININIVINNSHRNNSNSNSNSNN
SINELPSFGRVHLVQSRHNQRFYAIKVLKKEQVVRMKQVEHTNDERRMLQRVKHPFLITL
WGTFQDANNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHDHHIIYRD
LKPENLLLDRHGHLKITDFGFAKEVKDITWTLCGTPDYLAPEVVSSKGYNMSVDWWSLGI
LIFEMLCGFTPFWDGGSPMNIYENITKCRVKYPPYMHPDAQDLLSQLITPDLTVRLGNLH
GGSQDVKNHPWFAEVTWDRLARKDIDAPYIPPVKGGQGDASQFDMYPEETEAYGAEGDDP
YGHFFWDF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcagccacaacaacagcagcaacagcaaccaccaccacaacagcagcagcaaa
aacaacaacaacatcatcatcagcacaatcatcatcatcatcatcattgccatcaacatc
aacattgtcatcaacaacagccatcgcaacaacagcaacagcaacagcaacagcaacaac
agcatcaacgagctgcccagttttgggcgtgttcatctggttcaatcgcgacacaaccaa
cgattctatgcgataaaggtgctcaagaaagagcaagttgtgagaatgaagcaagtcgag
catacaaatgatgagcgaaggatgttgcagcgggttaagcatccctttcttatcacactg
tggggcacctttcaggatgccaataatctatatatggttatggacttcgtggagggcgga
gagttgtttagtttactgaggaagtcacagcgatttcccaaccccgttgcgaaattctat
gctgctgaggttacccttgcgttggaatatctgcatgatcatcacattatatatcgagat
ttgaagccggagaaccttctcctcgatcggcacggccacttgaaaatcacagattttgga
ttcgccaaggaagtcaaagatattacatggaccttgtgcgggacacctgattatcttgcg
ccggaggtggtatcatcaaaaggatacaatatgtctgttgactggtggtcccttggcatc
ctcatattcgaaatgctctgcggtttcactccgttctgggacggtggctccccaatgaac
atctacgaaaacatcaccaaatgccgcgtcaaatacccgccttacatgcacccggacgct
caggaccttctctcccaactgatcacgccagatcttacggtacgactggggaacttgcat
ggcggctcgcaagacgtgaagaaccatccgtggtttgcggaagtgacgtgggatcgatta
gcgaggaaggatattgatgcgccctatataccacctgtgaagggagggcagggcgatgca
agccagtttgatatgtatcccgaggaaacagaggcgtatggggctgaaggggatgatcca
tatggtcattttttttgggacttttaa

DBGET integrated database retrieval system