KEGG   Ajellomyces capsulatus: HCAG_03889Help
Entry
HCAG_03889        CDS       T02229                                 

Definition
cAMP-dependent protein kinase type 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aje  Ajellomyces capsulatus
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:aje04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 368 aa AA seqDB search
MHRSHNNSSNSNHHHNSSSKNNNNIIISTIIIIIIIAININIVINNSHRNNSNSNSNSNN
SINELPSFGRVHLVQSRHNQRFYAIKVLKKEQVVRMKQVEHTNDERRMLQRVKHPFLITL
WGTFQDANNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHDHHIIYRD
LKPENLLLDRHGHLKITDFGFAKEVKDITWTLCGTPDYLAPEVVSSKGYNMSVDWWSLGI
LIFEMLCGFTPFWDGGSPMNIYENITKCRVKYPPYMHPDAQDLLSQLITPDLTVRLGNLH
GGSQDVKNHPWFAEVTWDRLARKDIDAPYIPPVKGGQGDASQFDMYPEETEAYGAEGDDP
YGHFFWDF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcagccacaacaacagcagcaacagcaaccaccaccacaacagcagcagcaaa
aacaacaacaacatcatcatcagcacaatcatcatcatcatcatcattgccatcaacatc
aacattgtcatcaacaacagccatcgcaacaacagcaacagcaacagcaacagcaacaac
agcatcaacgagctgcccagttttgggcgtgttcatctggttcaatcgcgacacaaccaa
cgattctatgcgataaaggtgctcaagaaagagcaagttgtgagaatgaagcaagtcgag
catacaaatgatgagcgaaggatgttgcagcgggttaagcatccctttcttatcacactg
tggggcacctttcaggatgccaataatctatatatggttatggacttcgtggagggcgga
gagttgtttagtttactgaggaagtcacagcgatttcccaaccccgttgcgaaattctat
gctgctgaggttacccttgcgttggaatatctgcatgatcatcacattatatatcgagat
ttgaagccggagaaccttctcctcgatcggcacggccacttgaaaatcacagattttgga
ttcgccaaggaagtcaaagatattacatggaccttgtgcgggacacctgattatcttgcg
ccggaggtggtatcatcaaaaggatacaatatgtctgttgactggtggtcccttggcatc
ctcatattcgaaatgctctgcggtttcactccgttctgggacggtggctccccaatgaac
atctacgaaaacatcaccaaatgccgcgtcaaatacccgccttacatgcacccggacgct
caggaccttctctcccaactgatcacgccagatcttacggtacgactggggaacttgcat
ggcggctcgcaagacgtgaagaaccatccgtggtttgcggaagtgacgtgggatcgatta
gcgaggaaggatattgatgcgccctatataccacctgtgaagggagggcagggcgatgca
agccagtttgatatgtatcccgaggaaacagaggcgtatggggctgaaggggatgatcca
tatggtcattttttttgggacttttaa

DBGET integrated database retrieval system