KEGG   Histoplasma capsulatum: HCAG_03889Help
Entry
HCAG_03889        CDS       T02229                                 

Definition
(RefSeq) cAMP-dependent protein kinase type 2
Organism
aje  Histoplasma capsulatum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 368 aa AA seqDB search
MHRSHNNSSNSNHHHNSSSKNNNNIIISTIIIIIIIAININIVINNSHRNNSNSNSNSNN
SINELPSFGRVHLVQSRHNQRFYAIKVLKKEQVVRMKQVEHTNDERRMLQRVKHPFLITL
WGTFQDANNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHDHHIIYRD
LKPENLLLDRHGHLKITDFGFAKEVKDITWTLCGTPDYLAPEVVSSKGYNMSVDWWSLGI
LIFEMLCGFTPFWDGGSPMNIYENITKCRVKYPPYMHPDAQDLLSQLITPDLTVRLGNLH
GGSQDVKNHPWFAEVTWDRLARKDIDAPYIPPVKGGQGDASQFDMYPEETEAYGAEGDDP
YGHFFWDF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcagccacaacaacagcagcaacagcaaccaccaccacaacagcagcagcaaa
aacaacaacaacatcatcatcagcacaatcatcatcatcatcatcattgccatcaacatc
aacattgtcatcaacaacagccatcgcaacaacagcaacagcaacagcaacagcaacaac
agcatcaacgagctgcccagttttgggcgtgttcatctggttcaatcgcgacacaaccaa
cgattctatgcgataaaggtgctcaagaaagagcaagttgtgagaatgaagcaagtcgag
catacaaatgatgagcgaaggatgttgcagcgggttaagcatccctttcttatcacactg
tggggcacctttcaggatgccaataatctatatatggttatggacttcgtggagggcgga
gagttgtttagtttactgaggaagtcacagcgatttcccaaccccgttgcgaaattctat
gctgctgaggttacccttgcgttggaatatctgcatgatcatcacattatatatcgagat
ttgaagccggagaaccttctcctcgatcggcacggccacttgaaaatcacagattttgga
ttcgccaaggaagtcaaagatattacatggaccttgtgcgggacacctgattatcttgcg
ccggaggtggtatcatcaaaaggatacaatatgtctgttgactggtggtcccttggcatc
ctcatattcgaaatgctctgcggtttcactccgttctgggacggtggctccccaatgaac
atctacgaaaacatcaccaaatgccgcgtcaaatacccgccttacatgcacccggacgct
caggaccttctctcccaactgatcacgccagatcttacggtacgactggggaacttgcat
ggcggctcgcaagacgtgaagaaccatccgtggtttgcggaagtgacgtgggatcgatta
gcgaggaaggatattgatgcgccctatataccacctgtgaagggagggcagggcgatgca
agccagtttgatatgtatcccgaggaaacagaggcgtatggggctgaaggggatgatcca
tatggtcattttttttgggacttttaa

DBGET integrated database retrieval system