KEGG   Ajellomyces capsulatus: HCAG_03907Help
Entry
HCAG_03907        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     HCAG_03907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 543 aa AA seqDB search
MENQSSWTCDANHAIHISMVQPVETKLNTLSTFRPEFTYPIFGEEETIFGYKGLNIRLRF
SAHDLRLNVHISYNEKFKTVADVAPVDLFTTLDPWLPKSSFVPLEEFEQSVLNDEAAKDF
KPPGKLVHSYSSKQRNYEIWAGSLVNPEVRTLLDRIQIFVSFFIEGGRPIATDDLEWTLQ
RWTVYFVYEKIDPPTPTAPSYSFVGYATTYRWYFYLHEPSNSNNHKITDIPFPYAEEISF
SNLPARLRIAQFLILRPHQQSGHGSQLYHTIHSACLADPTLHELTVEDPNEAFDYLRDTN
DYKTLLPEFLKHNITINANPYPPEDSNANNGQNNDSKKARRSRRPRFMPTSTLLPTATLH
ALRIQYKLAPVQFAHIVEMYLLSQIPTSHRGSGVGMGAGEAAPTTTPMARLLVQKWRAPN
EDDRRYYWWRMLVKQRLYKRHRDLLIQLDRAERLEKLEETVGNVEEGYDGLLKAFENRET
QEGGNGDVGREEDSPARKRGKRKFTVFEDEDEENEDQEGEDKDSGEVGMEGGEGNGDAKK
MKI
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccaatcatcttggacctgtgatgccaaccatgccattcacatatccatggtc
caaccagtcgaaaccaaactaaatacgctctccacgtttcggccggagtttacataccca
atatttggtgaggaggagacaatattcggctacaagggattgaacatccgactgcgcttc
tccgcgcatgatctccggctaaacgtccatatttcatacaatgagaagttcaagactgtt
gcagatgtcgctccggtggatttattcacgaccttggatccctggctcccgaaatcttcg
ttcgtgccgttagaggagtttgaacaatcggttctcaacgatgaagctgcgaaggacttt
aagcctccgggcaagcttgttcacagctattcaagcaagcagaggaattatgagatctgg
gcgggttctttagtcaaccccgaagttcgcacactgctcgaccggatacaaatatttgtt
tccttttttatcgagggaggcaggcccatcgcaacggacgatttagagtggacccttcag
agatggacggtctattttgtttacgagaagatagaccctccaacccctaccgcgccatca
tactcgttcgtaggatacgcaacaacttatcgatggtacttctacctccacgaacccagc
aactccaacaaccataaaatcaccgacattcccttcccatacgctgaggaaatctccttc
tccaatctccccgcacgcctccgcatcgcccaattcctcatcctccgtccccaccagcaa
tccggccacggctcccaactctaccacacaatccactcggcttgcctcgctgaccccact
ttacacgaactcacggtcgaagaccccaacgaagccttcgactacctccgcgacacaaac
gactacaaaactctcctcccagaattcctcaaacataacatcaccataaacgccaaccca
tacccaccagaagacagcaatgccaataacggccaaaacaatgattcaaagaaagcccgc
cgctctcgccgtccccgctttatgccaacttccacactcctcccaaccgccaccctccac
gcccttcgcatccagtacaagctcgccccagtccaattcgcgcacatcgtcgaaatgtac
ctcctcagtcaaatccctacatcccaccgcggaagtggcgtaggtatgggcgctggtgag
gcagccccgactaccacacccatggcacgccttctcgtacagaagtggcgcgcacctaac
gaggatgatcggcggtattactggtggcgcatgcttgttaagcagcggttgtataagaga
catcgggatttgttgatccagctggacagggcggagcggttggagaagttggaggagacg
gtgggaaatgtggaggagggatatgatgggttgctcaaggcgtttgaaaatagggaaaca
caggagggggggaatggagacgttggacgggaagaggatagccccgcaaggaagaggggc
aagcggaagtttactgtgtttgaagatgaggatgaggagaatgaggatcaggaaggtgag
gataaggatagtggtgaagtggggatggaaggtggagaggggaatggggatgcgaagaaa
atgaaaatttga

DBGET integrated database retrieval system