KEGG   Ajellomyces capsulatus: HCAG_03915Help
Entry
HCAG_03915        CDS       T02229                                 

Definition
similar to kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     HCAG_03915
Protein kinases [BR:aje01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   HCAG_03915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 424 aa AA seqDB search
MWRASDKLMETIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQFLSEELPIRLAHRVQ
ELGDLPDGLNEMPSIRKVRDWYAQSFEVLEEATPNPSIRDDRYRSSTTSILRANGTITNT
NNGVATIGNGNGRRTVAGNKRYFVSTDDGQDWPPELNEYNNRFSKTLHHIKRRHDGVVTT
VAQGILEYKRKRQRMQIDSNIQSFLDRFYMSRIGIRMLIGQHVALTDQTHVHHPHYVGII
CTKTNVRELAEEAIENARFVCEDHYGLFDAPKVQLVCRPDLDFMYVPGHLSHMLFETLKN
SLRAVVETHGAEKEAFPVTKVIVAEGREDITIKISDEGGGIPRSSIPLVWTYMYTTVDQT
PNLDPDFNKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDVYLHLNRLSSSS
EPLQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtggagagcgtccgacaagctgatggagactatccgtcactatgcctcgttccccgca
acaggagtctcactcaggcagatggtccagttcggcgacaggccgtccactggaaccctc
ttccgcgcatcccagttcttgtccgaagagctacccatccgcctcgcacaccgtgtccag
gaactcggtgacctccccgatggcttgaatgaaatgccgtccatacggaaagtccgtgat
tggtatgcacagtcgttcgaggtcctcgaagaagctacccctaatccaagcatacgagac
gaccgatatcgatcctcgacaacctcgatcctaagagcaaacggcaccatcaccaatact
aacaatggagtcgccactatcggcaacgggaacgggagaagaacagtggccgggaacaaa
agatacttcgtgtctaccgacgatggccaagactggccgcccgagctgaacgaatacaac
aacaggttctccaagaccctccatcacatcaaacggcggcacgacggcgtcgtaacgacc
gtcgcgcaggggatcctggaatacaaacgcaagcgccaacgcatgcagatcgactcgaac
atccaatccttcctcgaccgcttctacatgtcccgcatcggcatccgcatgctgatcggc
cagcacgttgccctcaccgaccaaacacacgtccaccacccccactacgtcgggataata
tgcacaaagaccaacgtgcgtgagctggccgaggaggccatcgagaacgcccgcttcgtt
tgtgaggaccactacggcctcttcgacgcgcccaaggtgcagttggtctgccggccggat
ttggatttcatgtatgtgcctggccacctgtcgcacatgctctttgagacgttgaagaac
tcgctgcgggccgttgtggagacccatggggcggagaaggaggctttccctgtgacaaag
gtgattgttgcggagggccgagaggatattacaattaagatctcggatgagggcggtggg
attccgcggtcgtctatcccgcttgtgtggacgtacatgtacaccacggttgaccagacg
ccgaatttggacccggactttaataagagtgacttcaaggcgccgatggctgggtttgga
tatgggttgcccatcagccggctttatgcgaggtattttggtggggatctgaagttgatc
agtatggagggctacggcacagacgtctacctccacctcaaccgcctctcttccagttcc
gaaccgctccagtga

DBGET integrated database retrieval system