KEGG   Ajellomyces capsulatus: HCAG_03972Help
Entry
HCAG_03972        CDS       T02229                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial precursor
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aje  Ajellomyces capsulatus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCAG_03972
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCAG_03972
   00020 Citrate cycle (TCA cycle)
    HCAG_03972
   00620 Pyruvate metabolism
    HCAG_03972
Enzymes [BR:aje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HCAG_03972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
MATTVICRSAACRSLLSKNASSIRESRHVYRLRDAVRPQLPTLSALARYYASKSYPPHTI
ISMPALSPTMTAGNIGAWQKKAGDVLSPGDVLVEIETDKAQMDFEFQEEGVLAKILKEAG
EKDVAVGNPIAVMVEEGTDISSFESFSLEDAGGEKTPAANKEPPQPQEPESRPAPTTEES
KPAALESESTSEKLQSSLDREPFIAPAVKALALERGVPLNDVKGSGPGGRVTKQDIEKYQ
PRAAATGATLPAYEDIPATSMRKTIANRLVQSVRENPHYFVTSNLSVTKLLKLRQALNAS
ADGKYKLSVNDFIVKACAAALLKVPAVNSMWIEENGQVSIRQHKTVDISVAVATPVGLIT
PIVKNVETLGLSSISSQIKDLGKRARENKLKPEEYIGGTFTISNMGMNSAVERFTAVINP
PQAGILAVGTTRKVAVPVEGEEEGNASSVKWDDQIVVTASFDHKVVDGAVGAEFMRELKN
VVENPLELLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaccgtcatctgtcggtccgctgcctgtcgttcgttactttccaaaaacgca
tctagcatacgcgaatcacggcatgtgtatcgcctccgtgatgctgtccgaccgcaatta
cccaccctttcagcccttgccagatactatgcctcaaaatcttaccctccacacacaatt
attagcatgcccgcgttatccccaacaatgactgctggcaatatcggggcttggcagaaa
aaagccggagatgtcctttctcccggtgatgtgctagtggaaatcgaaacagacaaggcc
cagatggatttcgaattccaagaagaaggagttctggcaaagattctaaaggaagctggc
gagaaagatgttgccgtgggcaatccaattgcagtcatggtggaagaggggactgatatt
tcttctttcgagtccttctctctggaagatgctggtggggagaaaacgcctgctgcaaac
aaggagcctccgcaacctcaggagccggaatccaggcctgctcccacaaccgaagaatcg
aagcccgcagctctggagtccgagtctaccagtgagaaattacaatcgagtcttgacaga
gagccgttcattgctcccgcagtcaaggctttggcgttggaacgaggcgtgccgctcaac
gatgtcaagggctccggtcctggtgggcgagtgacaaaacaagatatcgaaaaataccag
ccccgcgccgcagctacgggtgctactttgccagcttatgaagatatccctgccacatcc
atgcgcaaaaccatcgcaaaccgcctcgtccaatccgtccgagaaaatccacactacttc
gtaacctcaaacctttccgttactaagcttctcaagctgcgccaggccctcaatgcctcc
gcagatggtaaatacaagctctcggttaacgatttcattgtcaaagcctgtgcagccgcc
ctcttaaaagtgcctgcagtaaactcgatgtggatcgaggaaaacggccaagtgagcatc
cgccagcacaagacggtcgacatcagtgttgcggtagccactcccgtcggcctcattaca
cccatagtgaagaacgtcgaaactctcggcctgtccagcatctccagccagatcaaagat
ctgggtaagcgcgctcgcgagaataagttgaagcccgaggaatacatcggtggcaccttt
acgatcagcaacatgggcatgaactctgccgttgagcgtttcaccgccgtcatcaacccg
ccacaagctggtatactagctgtgggtacgacgcgcaaggtagctgtgcccgtggaaggt
gaggaggagggcaacgcgagctctgtgaaatgggatgaccagattgtggtgactgccagt
ttcgaccataaagttgttgatggagcggtgggggccgagtttatgagagagctgaagaat
gttgtggagaaccctctcgagctacttctttag

DBGET integrated database retrieval system