KEGG   Ajellomyces capsulatus: HCAG_04010Help
Entry
HCAG_04010        CDS       T02229                                 

Definition
similar to ubiquitin specific protease 11
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     HCAG_04010
Peptidases [BR:aje01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   HCAG_04010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1549 aa AA seqDB search
MSAPDNVRNPLPPLPDDGSENDRQEFHSTPAVKRPAAEMGEDDRPSLDVEMGSDSFDGNE
DQNKDQSSNGKKQMERPTRQRRAVSVDMIGQNGTITTTNNSMVGTEMKPGSTKCLSMEDA
NSSSSDNVYPTPSSMSTYTSYTREDAKPRASSHTTHDRPPIDEQVAAVTKLLMQPLMDQQ
KGYVVSANWLGRVLSRSSKGGLQREKADKTASEGEIGAVDNSDLVLVTDPSIMYKDETGE
PFVPLRPGLQMGEDFEVLPEDAWELIMKWYGLSPESPAIIRYAHNTTVGSTEHVQYELNP
PIFTILKLPNPSQSPTQIAQDRARVPIKTLASRHTQFQQWLRNVKDLASIEMSTKVRVWR
ILEGLNSTTTSGIITPAASRSASPAPGATLTASAGNSFLLDVNKFVALVEGSQRELLEMK
DQTSNPKYNGSLTLHLAGLGSDDVIVLEEQVGGPAGGEWISDGAGKSSNRLAVAAHRAGP
QNKGKGKLPTASGRASPAIGAVSRGRPRKDGRSPGVTGLSNLGNSCYMNSALQCVRSVEE
LTQYFLQDEYRKDLNPGNPLSHDGNVAKAYANLLHQLYDDNGTSSFAPRQFKQTIGRYGP
SFSGYGQQDSQEFVLFLLDGLQEDLNRIQKKPYIEKPDSTDDMVGNNAALQEFANKCWEI
YKARNDSVITDLFAGMYKSTVVCPVCDKVSIIFDPFSNLTLQLPIENLWSKEIFFFPLHS
RPIRVAVDIDKNASIKALKEYVGQRVGVPTNRLVMAEIYKHKFYKMFENTSSIGECQIGS
SDDIGIFELESVPTSYDPDRAPSRSVYSSLAFSHSNTTNQEIPSFDSPKCDRMIIPIFNR
VIKPQGAKITRQLFGAPSYIIITRKESYDYDSILRKVLRNVANLTTRDILREDEGDIMMN
SSAAEDSDTVVTNDDDFDSSDPKIKASSVDGEDGLVDISMRDGSDSSTRTKSSVKGDTTP
IPKVLRPNNFIPPMLRNLFEIKIMRSTDAVPTGWSTVDEIKEFTSMTSRLPRKQAKRTTT
KNSPASRGSSPLSSEDELSGPARRVDIARSRDNNDDSDGCSSQKTKESGTESGSDSYPGP
SALLHGSGRRKLKLSTSKKGPPEAIPLIRSGEGIVLDWNEHAYDGLFAGDPLDDDGLRGS
ATWMSIDCLPDPELEQKRQLRQTRKKRGISLGECLDEFGKEEILSENDAWYCPRCREHRR
ASKKFELWKCPDILVMHLKRFSANRGFRDKIDALVDFPLELDMSGRVQMPEEGKSLQYEL
IAVDNHYGGLGGGHYTAYAKNFFDGCWYEYNDSHVSKKNNPASVVTSAAYLLFYRRKSDV
PLGGEYLACITEAAKNPENDDSDSQPDSRTLSPSGEDLRLGGSSRNGSSSALIGAGAIHQ
AGDGGLRGGIQARDDDSLPEYSELHHHNHLEGMDLEDEGFGSTFGPDLNFPNHPSWSFDR
AAEPYGGGVSGLVPAPANSFYDGDGDDDLDDEASNKAVGGGDMSDSESRLAMLNDSGDQD
GLIFEDADLSSSTTAVRNIMQPPDLDDDDDDSMPVVELRVPEEEGPAAL
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaccggacaatgtgcggaacccgcttcctcctttgccagatgatggctctgag
aatgatcgacaggaatttcactccacgcctgccgtaaagcggcctgctgcagagatgggg
gaggatgaccgcccatccctggatgtcgagatgggttcagattcatttgatggcaatgaa
gatcagaataaggatcagtcgtcaaatggcaagaagcaaatggagcgaccaacgagacaa
cgtagagctgtctctgtggatatgattggccagaatggtaccattacgacgactaataat
agtatggttgggacggagatgaagcccggaagcactaaatgcctttctatggaggacgca
aatagctcgtcgtcagacaatgtctatcctacgccgtccagtatgtcaacgtatacttct
tacacacgagaagatgctaaacctcgggcttcctcccataccacccacgatcgcccccca
atcgatgagcaggttgccgctgttaccaaattattgatgcaaccgttaatggatcagcag
aagggatatgtggtttcagcgaactggctaggacgcgtcctttctagaagctcaaaggga
ggcctgcagcgagaaaaagctgataagactgcctcggagggcgagattggtgctgttgac
aattcagacctggttctggtcactgacccatcaatcatgtacaaggacgagactggtgag
ccgttcgtccccttacggccaggcttgcagatgggagaagactttgaggtacttcccgaa
gatgcgtgggaattgatcatgaaatggtacgggctctcgcctgaatcccctgccattatt
cgatatgcccataacacaactgttggctctacagagcatgtccaatacgaacttaacccc
ccaatctttaccatcctgaaactgcccaatccttcacagtccccaacgcaaattgctcaa
gatagggcacgcgttcccatcaaaaccttggctagcaggcatacacaattccaacagtgg
ctgcggaatgtgaaggacctggcatctattgaaatgtctacgaaggttcgtgtctggaga
attctcgagggcttaaatagcaccacaacttccggtatcatcactccagcagcctcgaga
agtgcgtccccggcccctggtgccacattgaccgctagtgcgggaaacagctttctgttg
gacgtaaacaagttcgttgctcttgtggaaggctcccagcgagaattgttagaaatgaag
gaccaaacatcgaatccaaagtataatggcagtctcaccttgcaccttgcgggtttgggg
agtgacgatgtcattgtgctcgaggaacaagtcggtggtcccgctggtggggagtggatt
tctgatggtgccggtaaaagttcaaatcgacttgcggtcgctgcacatagggccggcccg
cagaacaagggcaaaggaaaactccccactgccagcggccgagcatcgccggcgattggc
gctgtttccaggggaagaccgcgcaaagacggccgatctcctggtgtcaccggcttgagt
aaccttggaaatagttgctacatgaattctgcgttgcaatgcgttcggagcgtagaggag
ttgacacaatatttccttcaagatgagtacaggaaagaccttaaccctggcaatccactt
tctcacgatgggaacgtggccaaagcctatgcaaacctgttacatcagctctatgatgac
aatggcacttcttcctttgctcctcgccaattcaagcagaccattggccgatatggccct
tcattctcgggttatgggcagcaggattcccaggagtttgtgcttttcctgctggatggc
ttacaggaggatttaaacagaatccaaaagaagccatatatcgagaagcctgattctacg
gatgacatggttggcaacaacgccgcgcttcaagagtttgctaacaagtgctgggaaatc
tacaaggcacggaatgactcagtaattactgatcttttcgcgggaatgtataagtcaacg
gtagtttgccccgtatgtgacaaagttagcatcattttcgatccattcagtaacctcact
ctgcaactcccgattgagaatctatggagcaaagagatatttttcttcccacttcattct
cgccctattcgggttgctgttgacattgacaaaaatgcgagtatcaaggcattgaaagag
tatgtgggtcaaagggtaggcgtccctaccaatagacttgtgatggctgaaatatacaag
cacaagttctataagatgttcgaaaatacttcgagcattggagaatgtcaaattggtagc
tccgatgacatcggcatttttgagctagaatctgtgccgaccagctacgacccagataga
gctcccagtcgatcggtttattctagtctcgcattctcccacagtaatacaaccaaccag
gaaataccatcgttcgactcgccaaagtgcgatcgcatgattatcccaatcttcaaccgc
gttattaaacctcagggtgcaaagatcacacggcagttattcggtgctccttcgtacatt
atcattacacgcaaagaatcatatgattacgatagcatccttcgcaaggttctgcggaat
gtggcgaacctgacgacccgagacattcttcgcgaggatgaaggggatattatgatgaac
tcaagtgctgctgaggactctgatactgttgtgaccaatgatgacgattttgactcctca
gaccccaagatcaaagcctcctcagtcgacggtgaagacggactagttgatatatcgatg
cgagatggttctgattcatccaccagaaccaaatcaagcgtgaagggtgataccacgccg
attccgaaagttcttcgacctaataatttcatcccgcccatgcttcgcaatttattcgaa
atcaaaataatgcgatcaactgacgctgttcccactggatggtctacagtcgatgagatc
aaagaatttacgtcaatgacctccagattaccgagaaaacaagccaagagaaccactaca
aaaaattcccctgccagccggggaagtagccctcttagtagcgaagatgagctcagcggc
cctgctcgtcgtgtagatatcgctcgttcaagggataacaatgacgattctgatggctgt
agctcccagaaaactaaggagagtggtacagaaagtggctcagattcatatcctggtccc
tccgcgttacttcacggctcaggacgccgaaaactcaagctttcgacgtccaaaaaagga
ccccccgaggctataccgctcattcgttccggggagggtattgttctggattggaatgaa
catgcatatgacggtctttttgccggtgacccgcttgatgatgatggactgcgaggttcg
gcgacatggatgagtatcgattgtcttcccgaccctgagcttgagcagaaacgtcagctg
cgccagacccggaaaaagcgcgggatcagtctcggtgaatgcctcgatgagtttggtaag
gaggaaatcctttcggaaaacgacgcatggtactgccctcgctgccgggagcacagacgt
gcgtcaaagaaatttgagctgtggaagtgcccggatattcttgtgatgcatcttaaacgc
ttcagtgccaaccgagggttccgtgataagatcgacgcgctggtcgatttccccctcgag
ctcgacatgagtggccgggtccagatgccggaggaggggaaaagtttgcaatatgagttg
attgcggtcgataaccattacggtggccttggcggtggacattatacggcgtacgcgaag
aacttttttgatggttgttggtatgaatacaatgactcccatgtttcaaagaaaaacaac
cctgcctccgtagttacatcagctgcatatcttctattctatcgtcgtaagtctgacgtc
cctctcggcggagagtatctagcctgcatcactgaggcagccaaaaatcccgaaaatgac
gactctgattcacaacccgactcccgcacactttccccttcgggggaagacctgcgcctc
ggcggctcctcccgcaatggatcgtcgagcgctttaatcggagccggagcaattcaccag
gcgggagatggtggtttgcggggcggaatccaggcgagggatgacgacagcctacccgag
tactcggaactccaccaccataaccacttggaaggcatggatctggaggacgaaggattc
gggtcgacattcggccccgatttaaattttcccaaccatcccagctggtccttcgaccga
gccgcagaaccctacggtggcggcgtctccggcctcgtacccgcccccgcgaactcattt
tatgacggggacggcgacgacgacctcgacgacgaagcaagcaacaaagccgtcggtggc
ggtgacatgagcgactcggaatcgcgcctggcaatgctgaatgattccggggatcaggat
ggcttgatttttgaggatgcggacttgtcatcatcaacaacagctgtgcgaaatatcatg
caaccaccagatctagatgatgacgatgatgattccatgcctgttgttgaactgcgggtt
cctgaagaggaggggccggcagcattgtaa

DBGET integrated database retrieval system