KEGG   Ajellomyces capsulatus: HCAG_04084Help
Entry
HCAG_04084        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
aje  Ajellomyces capsulatus
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aje00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1266 aa AA seqDB search
MSRASAGFADFFPTAPSVLQKKRSSKAAQDRPKGKPKHDDDAQPSNPALAASTAGRPAAP
GAEATRASGNNARGDTNNYSNNHSDTNSNSNITPDESTAVVVAREDVNVTPGDANGVGSS
SSTSTGSSIFSTSNLPQSGLTPSNGIIHPHALTPLTNANSSPSGKIGSPSGQKSNAGTGE
IRPTSRFVDDIKATATTPLQTPPNPRNQARPAGDGPKGYRLTYDPDLERKPLSKEKRRKP
QYQVFGTAENEVPPADPRLAIANYTRGAGCKQKTKYRPAPYILRPWPYDPATSVGPGPPT
QIVVTGYDPLTPLAPISALFSSFGDIAEIKNKTDPNTGRFLGVCSIRYKDSRMFRGGGPL
LAAQAARRAYLECKKEQRIGVRRIMVSLDRDGVVSDRLVERIIGWSQKQQEPPPLVMKEK
SKPEEQNNLPPPTAPKGPSRKSNIPIPEGPRATMMKPPLPSLIEETPILSQIKRDPYIFI
AHCYVPVLSTTIPHLERRLKLFNWKSVRCDKTGYYVIFENSRRGEEETERCYKMCHMTAL
FTYVMNMESQPYGNPNYIRSPSPERVKVELREKAERERLKKEDELDIEEEKKLRAADLDP
SREVLRVLVSELRDKLLEDVKSRIAAPALYDFLDPSRHTAKRQKLGISDPESNVRPAFRI
DTSDDAIIGTPDSRAESLARSRGPFGHSNILSLPRIRKSQGLETANDAFMDERRRRPPRR
KEFRPLYHRLQQLEGEESDDERRTSFTRDTEEQDSRPLSRMSMTSVSENEDEFGYEPVTT
KVDLQQLDLKAIKDATVEELEHTIIDLSPTSKKRKRISEELEARKRQKEDDDLDSAKPDG
QVKPREAESDVEEAAKVIEPVTLTKAKKRRMKKSKKQIFEEREALKLKQLEGTDHVPSKD
DILIEAPTIEEEKLIEVGVGEILEETKPEVEWGVSRDVPRPTVEDDETIILDLDGWQNLI
KDDEDIRFLREALEEYPPSNIGNLSAWAWKQKEIKAINRAGERGPVHTETKINGYYLPNS
TGCARTEGRKRILESEKSKYLPHRIKVQKAREEREALAKADPQAAAAEAARLAAARTISK
STSRSTRVNNRRLIADINAQKQALPMQSGDGDVLRFNQLKKRKKPVRFARSAIHNWGLYA
EENISANDMIIEYVGEKVRQQVADMRERRYLKSGIGSSYLFRIDENTVIDATKRGGIARF
INHSCTPNCTAKIIKVDGSKRIVIYALRDIERDEELTYDYKFEREWDSDDRIPCLCGSTG
CKGFLN
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgcctcggcgggcttcgcagacttcttcccaaccgctccctcagtcctccag
aagaagcgctcctccaaagccgcccaggatcgaccaaaaggcaagcctaaacacgatgat
gatgcccagccttccaatccggcactcgcagcctccaccgccggtcgtcctgctgcccct
ggtgcggaggctaccagggcctcaggcaacaatgcccgaggcgataccaacaactacagc
aataatcacagcgacaccaatagcaatagcaatattacacctgatgaatccactgccgtg
gttgttgctcgcgaggatgtaaatgtgactcccggcgatgctaacggtgtcggctcgtcc
agctccaccagcacgggctcttctatcttcagcacctccaatttgccccagtctggccta
acgccttctaacgggataatacatcctcatgccctcacccctctaaccaatgcaaattcg
tctccctcgggcaaaattggcagtccgtcgggccaaaaatcaaatgctggaactggcgaa
ataaggcccacaagtcgctttgttgacgacatcaaagccacagccaccaccccccttcag
acccctcccaacccacgaaaccaagctcgaccggcaggagatggaccaaagggttacagg
ctgacatatgaccctgatttggagcgcaagcccttatccaaggaaaaacgcaggaaacct
caataccaagtcttcgggaccgcagagaatgaagttccgcctgcagaccctcgccttgcc
attgccaattatactcgtggcgccggatgtaagcagaaaacaaaatatcgccctgcgccc
tatattcttcgaccatggccgtacgatcccgctacctctgttggccccggtccgccgacc
caaattgtagtgactggctacgaccctctaacacctctagcaccgatcagcgccctcttt
tctagctttggagatatcgcagaaatcaaaaataagacggatcccaacactggtcggttt
ctgggtgtctgctctatacggtataaggattcgagaatgtttcgtggaggcgggccactc
ctagcggcgcaagctgcccgaagagcgtacctggagtgcaagaaggaacagcgtattggc
gtacgtcgaataatggtcagtctcgatcgtgatggtgtggtcagcgaccggctcgttgag
aggattattgggtggtcgcaaaagcaacaagagccccccccgctcgtgatgaaagagaag
agtaaaccggaagagcaaaacaaccttccgccccctacagcgcccaagggcccatcacga
aaatcgaacatacctataccagaaggcccgcgagcgacgatgatgaaacctcccctccct
tcgctcatcgaagaaaccccaatcctcagtcaaattaaacgtgacccttacatattcatc
gcccactgttatgtccccgtacttagtactacgattcctcatctggaaagacggttaaaa
ctcttcaattggaagtctgtgcgctgcgataaaaccggatattatgtaatttttgagaat
tcccgacggggggaagaggagactgagcgatgttacaagatgtgccatatgaccgcgtta
tttacgtatgtgatgaacatggagagccagccatatggcaatccaaactacatccgcagc
cccagccctgaacgtgttaaggtagaactgcgggagaaagctgagagggagcggctgaaa
aaggaggatgagttagatatcgaggaggagaagaaactacgtgctgcggatctcgatcct
tctcgggaagtacttcgtgttcttgtttctgaactaagagacaaactcctggaagatgtc
aagtccaggatagctgccccagcactctacgatttcctcgatcccagtcgccatactgct
aagcgacaaaaactgggaatctctgatcctgagagcaacgtccgccccgcgttccgaatt
gacacttccgacgatgctatcattggaactcccgattcgcgcgcagagtccttagcacgg
agtcgcgggccgtttggccattcaaatatcctctccctccctcgtatccgcaaatcgcaa
ggtttggagacagctaacgatgcctttatggatgagcggcgaagacggccgccaaggcga
aaggaatttagacccctctaccatcggctgcaacagctcgaaggcgaggagtcagatgat
gaacgaaggacttcatttactcgagacactgaggaacaggacagtcgaccacttagtcgt
atgagcatgacttcggtttcggaaaatgaagatgaatttggatatgaaccggtgactacc
aaagttgacttgcagcaattagatctcaaggccattaaagatgccaccgtcgaggaactc
gagcatactattatcgacctttcgcctacttctaaaaaaagaaagaggatttcggaagaa
ctcgaagcgcggaaaagacaaaaagaggatgacgatcttgattctgcgaagcctgatggg
caagtgaagcctagagaggctgagtcggatgttgaggaagctgcaaaagttatcgagcca
gtgactttgaccaaggccaagaagcgcaggatgaagaaatccaagaagcaaatctttgag
gagcgggaggcacttaaactgaaacaactggaaggcaccgaccatgttccttcgaaagac
gatattctgatcgaagctccaacaatagaggaagagaaattgatcgaggtgggtgttggt
gaaattttggaggaaacaaagcccgaagtcgagtggggtgtttccagagacgtccccagg
cctactgtcgaggatgatgaaactatcatcttggatctcgacggttggcaaaacctcatc
aaagacgacgaggatatccgcttccttcgagaagcgcttgaagaatatccaccttctaac
attggaaacctttccgcctgggcctggaaacaaaaggaaatcaaagctatcaatcgtgcc
ggtgaaaggggacctgtccataccgaaactaagatcaacggctactacctccccaactca
actggatgcgcccgcaccgaagggagaaaacgaatccttgaatctgagaaatcgaagtac
ctccctcatcgtatcaaggtccaaaaggcccgcgaagaacgcgaggctcttgcaaaggca
gatccccaagccgccgctgcagaagccgcacgactcgctgctgccaggacaatatccaag
tccacctcccgttccacccgagtcaacaaccgtcgtctcattgccgacattaatgcccag
aaacaggccttgccgatgcagagcggcgatggcgacgtgctgcgctttaaccaactgaag
aaacgtaagaagcccgtccgtttcgcgcgctcggccattcacaactggggcctgtatgct
gaggagaatatatctgccaatgacatgattatcgagtatgtcggtgagaaggtccggcag
caggtggctgatatgcgcgagcggaggtacctcaagagcggcattgggagcagctatctc
ttccgcattgatgagaatacggtcattgatgcgacgaagaggggtggcattgcgcggttt
attaaccatagttgcactccaaattgtacggcgaagattattaaggtggatgggagtaag
aggattgtaatttatgcgttgagggatattgaacgagatgaagaacttacttacgattat
aaatttgagcgggaatgggatagcgatgatagaatcccttgtctctgtggctcgactggt
tgtaaaggatttcttaattga

DBGET integrated database retrieval system