KEGG   Ajellomyces capsulatus: HCAG_04175Help
Entry
HCAG_04175        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
aje  Ajellomyces capsulatus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    HCAG_04175
Translation factors [BR:aje03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    HCAG_04175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 280 aa AA seqDB search
MAPSKWDDEEESTPPSSPPLVSTTTQRRKFDDEEDSDDVVDDWEAAEDSEVEREKAAKAA
AAKAKAEAEAAANKKSKTQRIQERKEQRRHQQLSSEDDDDDDDDEDEAAVRARLRRTEKD
ADLSHAQDLIGDIDLNRTRSTIPKAAVVIGDKSDPTKSIDLSAIPLFKPGTKTQFAELTN
ALIPLLTAQSKKPQYAMWAQDFAKKLVKELPSGDIKKIASALTAVGNEKLKEEKAADKGG
KKSKAAKTKTSVVVGRDVAGARGADLTAYDGDDLGDDDFM
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttcaaagtgggacgatgaagaggagagtacacccccctcctcccctcctctt
gtttcaacaacgacacagagacgcaagttcgatgacgaggaggatagcgatgatgtagtc
gacgactgggaagccgccgaagactccgaagtcgagcgcgaaaaggcagccaaagccgcc
gcagcgaaagcaaaagccgaagccgaagcggccgcgaacaagaaatcaaaaacccaacgg
atacaagagcgcaaggagcaacggcggcaccaacaactatccagcgaagacgacgacgac
gatgatgatgacgaagacgaggccgccgtgcgcgcacgtctccggcgcacagagaaggac
gcagacctctcccacgctcaggacctcatcggcgacatcgacctgaaccgcacccgctcc
accattccgaaagccgccgtcgtcatcggcgacaaatccgacccgaccaaatctatagac
ctctccgccatccccctcttcaagccggggaccaagacgcagttcgcagagctgaccaac
gcgctgatcccgctgctgacagcccagtcgaagaagccgcagtatgccatgtgggctcag
gatttcgcgaagaagctcgtcaaggagttgccgagcggggatatcaagaagatagcgagc
gcgttgacggccgtagggaatgagaagctgaaggaggagaaggcggcggataaagggggg
aagaagagcaaggcggccaagacgaagacgagcgttgtggttgggagggatgttgcgggc
gcgcgcggcgctgatctcacggcgtatgatggtgatgatttgggtgatgatgactttatg
tga

DBGET integrated database retrieval system