KEGG   Ajellomyces capsulatus: HCAG_04225Help
Entry
HCAG_04225        CDS       T02229                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
aje  Ajellomyces capsulatus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aje00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    HCAG_04225
Exosome [BR:aje04147]
 Exosomal proteins
  Proteins found in most exosomes
   HCAG_04225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1631 aa AA seqDB search
MANPADIPIKLTELLQLKSIGVSTVESDRFVCVRQNVGGQQQIFVVNPKNPDEIIRRSIP
GASAIMHWNKYILAVRSEDGNLRIINLQTEQILKDVRFRVKILFWKWINERSLALVTATH
SYHWDVFGEKTQPVEASVHKERIDEEVDDEQWTAVIAVQAQDNSKPTLGKIQLYSRARSE
SQIIEGHAAAFGKIRVAGNPAETKIFTFAVRTSTAAKIHIVEIDNENPTKKFPKKAEQLF
FPPEAITDFPSSIQLSRKYDIAYIVTMFGFIHLYDLESGSCLFLNRISSRSIFATALDSE
SAGLVGVNRDGQVLAVSVDEEKIIPYILQKLNNEGLAVRLASKGGLPGADGFLKREFDSM
VARGDYVQAAKIAANSPRGFLRTPATINLLKNAPQPATGMSVILQYFGMLLDQGGMNQYE
SVELVRPVLQQGRKHLLEKWMSENKLGCSEELGDLVRPHDMNLALNIYLKANVPHKVVAG
FAETGQFDKILAFSKQAGYQPDYIQLFQHINMVQQATAFLLDALKDNKPEHAHLQTRLLE
MNLVNAPQVADAILGNEMFTHYDKARISQLCENAQLYQRALENTDDPAVIMRNIVRTDKL
NPEWLINYFGRLSVEQCLECMNEMLKSNLRQNLSAVVQIATKFSDLLGPTNLINLFEKYR
TAEGLYYYLGSIVNLSEDPDVHFKYIEAATAMNQLTEVERICRESNYYNPEKVKNFLKEA
RLTEQLPLIIVCDRFNFIHDLVLYLYQSQQYRSIEVYVQRVNPSRTPAVVGGLLDVDCEE
SIIKNLLSTVDAASIPIDDLVSEVESRNRLKILLPFLENTLATGNQQQAVYNALAKIYID
SNNNPEKFLKENDLYDPLIVGKYCEKRDPNLAYIAYRKGQNDLELINITNENSMYRAQAR
YLLERADPEIWAFVLNANNIHRRALVDQVVATAVPESAEPDKVSIAVKAFLDADLPGELI
ELLEKIILEPSPFSDNSSLQNLMMLTAAKADKGRLMDYIHKLSEFNADEIATMCVSVGLY
EEAFEIYKKVDNHLAATNVLVDSIVSIDRAQEYAEGVELPEVWSKVAKAQLDGLRISDSI
ASYIRAGDPSNYNEVIETATHAGKDVDLVEFLKMARKTLRESAVDTALAFCYARLDQLSE
LEDFLRGINVADVEASGDKAYEEGFHEAAKIFYTSISNWAKLATTLVHLEEYQAAVECAR
KANNIKVWKQVNEACVSKKEFRLAQICGLNLIVHAEELQDLVHQYERNGYFDELIAVLEA
GLGLERAHMGMFTELGISLSKYHPDKVMEHLKLFWTRINIPKMIRACEEANLWPELVFLY
CHYDEWDNAALAMMERAADSWEHHSFKDIIVKVANLEIYYRALNFYLQEQPLLLTDLLQV
LTPRIDVNRVVRMFEKSDNIPLIKPFLLNVQPQNKKAVNNAINDLLIEEEDHKTLRDSVE
NYDNYDPVELAQRLEKHDLVFFRQIAASIYRKNKRWEKSISLSKQDKLFKDAIETAAISG
KTEVVEELLRYFVDIGSRECYVGMLYACYDLIRPDVVMEISWRHRLTDFSMPYMINLLSQ
QVRTVELLKKDNEERKAREASQKKEEDNTPVLGGSRLMLTQGPAAAPPSASPIPFGHTNG
ITPQPTGFRPF
NT seq 4896 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcccgcagacatcccaatcaagctcactgagcttttacagctgaaatccatc
ggagtttcgaccgttgagtccgaccgcttcgtctgcgtacgacagaatgtcggtggccaa
cagcagatctttgtggtcaatcccaaaaaccctgatgaaatcatccgtcgttccatccct
ggcgcgagtgctattatgcattggaataaatacattctagccgtcaggtcggaagacgga
aatctccgaatcataaacctccagacggaacagatactgaaggacgttagatttagagtc
aagatattgttctggaaatggatcaatgagcgttctcttgccctggtgacagcaacccat
tcctaccactgggacgtattcggcgagaaaacccagcctgttgaagcatctgtgcataaa
gaaaggatagatgaggaggtggatgatgagcaatggacggcagttattgctgttcaggcc
caagacaacagcaagcccactctggggaagattcaactttattcccgtgcgcgatccgaa
tcccaaataatcgaagggcacgcagcagcctttggcaaaatccgcgtcgctggaaaccct
gctgaaacgaaaatcttcacgtttgctgttcgaacttcaaccgctgcgaaaatacacatt
gtggaaatcgacaacgaaaaccccactaaaaaatttcccaagaaagctgaacaactcttt
ttcccgccggaggccattacagatttcccctcttctattcagctttctaggaagtacgat
atcgcttacatcgtgacgatgttcggtttcattcatctgtacgatctggagagtggtagc
tgtctgtttttgaacagaatttcttctagatcaatattcgccacggcccttgattcggaa
tcggcgggtctcgttggagttaaccgcgatggccaagttcttgccgtcagcgtcgatgaa
gaaaagataatcccatacattctacaaaagctcaataacgaaggacttgcagtcagactc
gcgtcgaagggaggacttccaggagcggatggttttctgaagagagaattcgactcaatg
gtggcacggggagattatgtccaagctgctaagattgcagctaactctcctcgcggattc
cttcgtacgcctgcgaccattaatctcctcaagaatgctccgcagcccgcaacaggcatg
tccgttatcttgcaatattttgggatgctccttgatcaaggtggtatgaaccaatatgag
agtgtggagctggtgagacctgtgctgcagcaaggtcgaaaacatctcctggaaaaatgg
atgtccgaaaacaagcttgggtgttcggaggaacttggtgatctggtgcgcccacatgat
atgaatcttgcactcaacatctacttgaaagccaatgtgcctcacaaagtggtcgccggc
tttgccgaaaccggccagttcgacaagattttggccttctcaaagcaagccggataccag
ccagactacattcagctcttccagcatattaacatggttcaacaagcgactgctttcctg
ctcgatgcactgaaagataacaagcctgagcatgcacatcttcagacgagattgcttgag
atgaaccttgtcaatgccccgcaggtcgcggatgccatacttggcaatgagatgtttaca
cactacgataaagcaagaatatcgcagctttgtgaaaatgcacagctctaccaacgtgct
ctggagaataccgacgatcctgctgtcatcatgcgaaatattgtccgcacggacaagctg
aatccagaatggttaatcaactattttggacgcctatcggtcgagcagtgtttggagtgt
atgaatgagatgctgaaatccaacctccgccaaaacctgtcggctgttgttcaaattgcc
accaaattttcagatctccttggtccgaccaacttgatcaacctcttcgagaagtatcga
actgctgaaggcctttactattaccttggcagcattgtaaatctaagcgaagatccggat
gtccatttcaagtatatcgaagctgcaacggcaatgaaccaactgaccgaggtagagcgc
atttgccgggaaagcaattactacaacccagagaaagttaagaatttcttgaaggaagct
cgcctaaccgagcaactacctttgatcattgtttgcgaccgtttcaactttattcatgac
cttgtattatatctttatcaaagtcagcagtatcggtccattgaggtctacgtccaacgc
gttaacccatccagaactccagctgtcgtcggcggtttgttggatgttgactgtgaggag
agcatcatcaagaaccttctgtctacggttgacgctgcatcaattcccattgatgacctt
gtttctgaggtcgagtctcgaaatcgccttaagatccttcttccattcctggagaataca
ctcgccactgggaaccagcaacaagccgtttacaacgctctcgccaagatttatatcgat
agtaataacaacccagaaaaattcttgaaggagaacgatctctacgatcctcttatcgtt
ggaaagtattgcgagaagcgtgatcccaaccttgcctatattgcctatcgcaagggacag
aacgatcttgagctcatcaatatcaccaatgagaactccatgtaccgcgctcaagctcgt
tatcttttggagcgtgcggatcccgaaatatgggcttttgttcttaacgcgaataacatc
caccgccgggcattggtagatcaagtcgtcgccactgccgtgcctgagtctgcggagccg
gataaggtgtctattgctgtcaaggccttcctcgatgccgacttgccaggcgaactcatc
gaacttttggaaaagatcattttggaaccatcccctttcagtgataatagcagcctgcaa
aatctaatgatgcttaccgccgccaaagccgataaaggccgcctcatggattacatccat
aaactttctgagttcaatgccgatgaaattgcgacgatgtgtgtttctgtgggtttgtac
gaggaggcttttgaaatttacaagaaggttgacaaccatctggctgccaccaacgtcctt
gtcgattccattgttagcatcgaccgtgcacaggaatatgcagagggtgttgaacttccc
gaagtttggagcaaggtagcgaaggctcagctggatgggctccgcatttctgattctatt
gcgtcatatatccgagctggtgacccgtccaattataatgaagtaatcgaaactgccacg
catgctgggaaggacgttgaccttgtcgagttccttaaaatggctcggaaaacgctacgg
gaatctgctgttgataccgcattggccttctgctatgccaggttggatcaattaagcgag
ctagaggacttcttgcgaggtataaacgtcgcagatgtggaggcgtctggtgacaaggct
tatgaggaaggcttccatgaggctgccaagatattctataccagcatctccaactgggca
aaacttgccactactctcgtccacctcgaagaatatcaggccgccgttgagtgcgctcgg
aaagccaacaacatcaaagtatggaagcaagtcaacgaggcgtgtgtttctaagaaagaa
ttccgtcttgctcaaatttgcggtctcaatctcattgtacacgctgaagaattgcaggat
ttagttcatcaatatgagcgaaatggctatttcgatgagcttattgctgttttggaggct
gggctcggcctggagagagctcacatgggtatgttcacggaattgggtatctctttgtcc
aaatatcacccagacaaagttatggagcacctgaaactattttggacacgaatcaacatc
cctaaaatgatccgggcctgtgaagaggcaaacctgtggccagagctggtgttcttgtac
tgtcactatgatgaatgggataatgctgcactagcaatgatggaaagggcagcggactcc
tgggagcaccactctttcaaagatatcatcgtcaaggttgcaaatctcgaaatttactac
cgcgcgttgaatttctaccttcaggaacaaccactgctactgacagaccttctgcaagtc
cttactccacgtattgatgtcaaccgtgtcgttcgcatgtttgagaaatccgataatatt
cctcttatcaaaccattcttgcttaacgtgcaaccacagaacaagaaggccgtcaataat
gctattaatgacttgttgattgaagaggaagatcacaagaccttgcgagattcggtggag
aattatgacaactacgatcctgtggagctagcccagagacttgagaagcatgacctggtc
ttcttcagacaaatcgcggccagcatctaccgcaaaaacaagagatgggagaaatcaatt
tctctttcaaaacaagacaagctcttcaaggatgctatcgagactgcggctatctcagga
aagactgaagttgtggaagaactgctaagatacttcgtggatatcggtagccgagaatgt
tacgttggcatgctatacgcctgctatgacctcatccgaccagatgtggtcatggaaatc
tcatggcgccacagactgaccgacttttccatgccctacatgatcaatcttcttagccaa
caagtccgcactgttgagcttctcaagaaggacaacgaagaacgcaaggcccgcgaagcg
tcccagaaaaaggaagaagacaacaccccagttctaggtggatcacgacttatgctcacc
caaggcccggcggcggctccgccatctgcaagtcccattccgtttggccatacgaacggt
atcacgccccagcccactggattccgacccttttga

DBGET integrated database retrieval system