KEGG   Ajellomyces capsulatus: HCAG_04266Help
Entry
HCAG_04266        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
aje  Ajellomyces capsulatus
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:aje04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 398 aa AA seqDB search
MSPRRPLAPKDNNTPHRPAPPPPKMSVLETATAPAGATSSQARRKRVQVTINRKPFTRLD
CIGRGGSSRVYRVMAENCKIFALKRVNLEDVDPIALAGYKGEIDLLKKLENVDRVVRLFD
YEVNEEKHALSVLMEFGESDLQRILTLRLNTEDAVFDSAFTRYYWKEMLECVQAVHEFDV
VHSDLKPANFVLVKGNLKLIDFGIANKIQDDTVNVHREQQIGTPNYMAPEALIDINAASG
LPSTVGKMMKVGKPSDVWSLGCILYKMVYGEPPFAHITKPFERIMAIPNPKVIIEFPAFG
VGGASVPPGLIRTLKRCLQRDPRLRPTVQELLGQRDPFLYPEANLEGSVPMTQEMLGRIL
TNVVNHCKARGPPKEEDLAGWPAGFFAKIRSALEEDAL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcacctcgcagacccctagctcccaaggataacaacactcctcatagaccagctcca
ccgcccccaaaaatgagcgttctggaaacagcgaccgcacccgcaggagctacttcgtcc
caagctcggaggaaacgcgtccaggttaccattaatcgcaagccctttacaagattagac
tgcattgggcgagggggaagttctagagtctaccgtgtcatggccgaaaattgtaaaata
ttcgcacttaaaagagtcaatttggaggacgttgacccaattgcccttgctgggtataag
ggagagatcgatttactcaaaaagctcgagaacgtggatcgcgtagtgcgattgtttgat
tacgaagtcaacgaggagaagcatgcactcagtgttctcatggagtttggcgagtcggat
ctacaaaggattctcacgctacgactaaatacagaggacgctgtgtttgattctgccttc
acgcgatattactggaaggaaatgctcgagtgtgttcaagctgttcacgaattcgacgtc
gtccattcagatctcaaacctgccaatttcgtcctagttaagggaaacctgaaattaatt
gattttggcatcgcaaacaagatccaggatgacactgtaaatgttcaccgcgagcagcaa
atcggcactccaaattacatggcacccgaagctcttatcgacatcaatgccgcaagcggc
cttccctcgactgtcggaaagatgatgaaagtcggcaaaccaagtgacgtctggagttta
ggctgtatcctctataaaatggtctatggcgaaccaccctttgcgcacatcaccaaacct
tttgagcgcattatggccattcccaatccgaaggtgatcattgaattcccagcattcggc
gttggtggtgcatccgtaccaccaggcctcatacggactctgaagcgttgccttcagcgc
gatccgcgtctgcggcccacagtgcaggagttgcttggtcagcgagatccgtttctatat
ccagaagcaaacttggaaggttcggtgcccatgacgcaagagatgttggggaggatattg
acgaatgtcgtcaatcattgtaaggcaaggggacctccgaaggaggaggacctggccggg
tggcccgccggattttttgcgaagattcgatcagcgctcgaggaagatgcgctttga

DBGET integrated database retrieval system