KEGG   Ajellomyces capsulatus: HCAG_04350Help
Entry
HCAG_04350        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
aje  Ajellomyces capsulatus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aje00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    HCAG_04350
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     HCAG_04350
Peptidases [BR:aje01002]
 Metallo Peptidases
  Family M67
   HCAG_04350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 519 aa AA seqDB search
MTNTPPNNAQMQPPLNVEQIARQASEFEFDPFSPLRYWIRAAGLLIKEASIYEREGNDQQ
AYLLLFRHAQLVLSHIATHPDARQEDNRKAVAAAKREVQRNLSKLELLKPRINKRYERYV
QLLRGREAKKTTSLLGNDGVAIANAPVDPALAGIAEPLEAAQNKELAVKLAQREFNRRAT
ARTATQTRDPYAKDILETYGIEDFHESHDDEPADDLSRRLQNIRSKVPKTQRVERRLPSA
PHRPVSESQGDLQTAPIPQRLSDMGKLSSYKYPNIPRQPAFDIGQQPPPVPSKEPATSSS
SLPPQLPAKVKDSIPSPSESVTSSPLPEAICPPIPKKGLLSSTSATDGNVTPPADLQKFT
FKPSAYLENGTPLRTIFISPDLRKQFLYIAASNTKCNLETCGILCGTLISNAFFISKLLI
PEQESTSDTCEMVNEGAIFDYCDSEDLMVLGWIHTHPSQTCFMSSRDLHTHSGYQVMLAE
SIAIVCAPSKDPDWGVFRLTDPPGLKSVLACCGAVVFRL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataccccgccaaacaacgcccaaatgcagccgcctttgaatgtcgagcagatt
gctcgtcaagctagcgaatttgagtttgaccctttctctccattgcggtactggatacga
gcagcgggtttgcttattaaagaggccagcatctatgaacgtgaggggaacgatcaacag
gcatatcttcttctcttcagacacgcgcaactagtactctcacacattgcaactcacccc
gatgcacgacaagaggataatcgcaaagctgttgcggcagccaaaagggaagttcagaga
aacctgagcaagcttgagctgctgaagccccgcatcaacaagagatatgagcgttacgtc
cagcttctccgaggaagagaggccaaaaagacaacatcgctattgggaaacgatggcgtt
gcgattgcgaatgctccggttgatcccgcattagccggtatagctgagcctttggaagcc
gctcagaataaggaattggctgtgaaacttgcccagagggaattcaaccgaagggcaaca
gctcgaacggcaactcaaactagagacccgtatgcgaaagatatattggaaacctatgga
atcgaagacttccatgagagccatgatgatgagccggcagacgaccttagccgacgcctt
cagaatattaggtccaaagtcccaaaaacccagcgggtggagcggagattgccctcagcc
ccccatcgccccgtttcagagtctcaaggcgacctacaaacggctcccataccccagcgg
ctttctgatatgggaaagctatctagttataaataccccaatatacctcgtcaaccggct
tttgatatcggccagcaaccaccgcccgtgcctagtaaggagcctgcaacatccagctca
tctcttccacctcaactccctgccaaagttaaagattctattccttcaccttcagagtct
gttaccagctctccccttcctgaagcgatatgtcccccaatcccaaagaaaggattgctt
tcttctacctccgcaacagatggcaacgtaaccccgccggcggatctccaaaaatttaca
ttcaaaccatcagcatatcttgaaaatggcacccctctccgaactatcttcatatctcct
gacctccgaaaacaatttctctacatcgctgcctcaaataccaagtgcaatcttgaaacc
tgtggcatcctgtgtggaacattaatatccaatgcctttttcatttccaaacttctaatc
cccgaacaggagtctacatcagatacctgcgaaatggtcaacgagggagccattttcgac
tactgtgattccgaagatttaatggttcttggttggatacatactcatccatcgcagacc
tgcttcatgagctcgcgtgatttgcatactcattccggctatcaagtaatgttagcggaa
agtattgcgattgtttgtgcaccgagcaaggaccctgactggggcgtgtttcggctcacg
gacccacctggtttgaaatccgtgcttgcctgctgtggcgcagtggtgtttagactttaa

DBGET integrated database retrieval system