KEGG   Ajellomyces capsulatus: HCAG_04350Help
Entry
HCAG_04350        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
aje  Ajellomyces capsulatus
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:aje04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 519 aa AA seqDB search
MTNTPPNNAQMQPPLNVEQIARQASEFEFDPFSPLRYWIRAAGLLIKEASIYEREGNDQQ
AYLLLFRHAQLVLSHIATHPDARQEDNRKAVAAAKREVQRNLSKLELLKPRINKRYERYV
QLLRGREAKKTTSLLGNDGVAIANAPVDPALAGIAEPLEAAQNKELAVKLAQREFNRRAT
ARTATQTRDPYAKDILETYGIEDFHESHDDEPADDLSRRLQNIRSKVPKTQRVERRLPSA
PHRPVSESQGDLQTAPIPQRLSDMGKLSSYKYPNIPRQPAFDIGQQPPPVPSKEPATSSS
SLPPQLPAKVKDSIPSPSESVTSSPLPEAICPPIPKKGLLSSTSATDGNVTPPADLQKFT
FKPSAYLENGTPLRTIFISPDLRKQFLYIAASNTKCNLETCGILCGTLISNAFFISKLLI
PEQESTSDTCEMVNEGAIFDYCDSEDLMVLGWIHTHPSQTCFMSSRDLHTHSGYQVMLAE
SIAIVCAPSKDPDWGVFRLTDPPGLKSVLACCGAVVFRL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataccccgccaaacaacgcccaaatgcagccgcctttgaatgtcgagcagatt
gctcgtcaagctagcgaatttgagtttgaccctttctctccattgcggtactggatacga
gcagcgggtttgcttattaaagaggccagcatctatgaacgtgaggggaacgatcaacag
gcatatcttcttctcttcagacacgcgcaactagtactctcacacattgcaactcacccc
gatgcacgacaagaggataatcgcaaagctgttgcggcagccaaaagggaagttcagaga
aacctgagcaagcttgagctgctgaagccccgcatcaacaagagatatgagcgttacgtc
cagcttctccgaggaagagaggccaaaaagacaacatcgctattgggaaacgatggcgtt
gcgattgcgaatgctccggttgatcccgcattagccggtatagctgagcctttggaagcc
gctcagaataaggaattggctgtgaaacttgcccagagggaattcaaccgaagggcaaca
gctcgaacggcaactcaaactagagacccgtatgcgaaagatatattggaaacctatgga
atcgaagacttccatgagagccatgatgatgagccggcagacgaccttagccgacgcctt
cagaatattaggtccaaagtcccaaaaacccagcgggtggagcggagattgccctcagcc
ccccatcgccccgtttcagagtctcaaggcgacctacaaacggctcccataccccagcgg
ctttctgatatgggaaagctatctagttataaataccccaatatacctcgtcaaccggct
tttgatatcggccagcaaccaccgcccgtgcctagtaaggagcctgcaacatccagctca
tctcttccacctcaactccctgccaaagttaaagattctattccttcaccttcagagtct
gttaccagctctccccttcctgaagcgatatgtcccccaatcccaaagaaaggattgctt
tcttctacctccgcaacagatggcaacgtaaccccgccggcggatctccaaaaatttaca
ttcaaaccatcagcatatcttgaaaatggcacccctctccgaactatcttcatatctcct
gacctccgaaaacaatttctctacatcgctgcctcaaataccaagtgcaatcttgaaacc
tgtggcatcctgtgtggaacattaatatccaatgcctttttcatttccaaacttctaatc
cccgaacaggagtctacatcagatacctgcgaaatggtcaacgagggagccattttcgac
tactgtgattccgaagatttaatggttcttggttggatacatactcatccatcgcagacc
tgcttcatgagctcgcgtgatttgcatactcattccggctatcaagtaatgttagcggaa
agtattgcgattgtttgtgcaccgagcaaggaccctgactggggcgtgtttcggctcacg
gacccacctggtttgaaatccgtgcttgcctgctgtggcgcagtggtgtttagactttaa

DBGET integrated database retrieval system