KEGG   Ajellomyces capsulatus: HCAG_04467Help
Entry
HCAG_04467        CDS       T02229                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aje  Ajellomyces capsulatus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HCAG_04467
   00052 Galactose metabolism
    HCAG_04467
   00500 Starch and sucrose metabolism
    HCAG_04467
   00520 Amino sugar and nucleotide sugar metabolism
    HCAG_04467
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HCAG_04467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 511 aa AA seqDB search
MEIPVPSEEYSPLTDGDHGDRDVKAFENASTNVAASQMRNALNALADTVTDPKEKQRFEA
EMDNFFSLFRRYLNDKAKGNVLSWDRIAPPQPSQVVEYSELGNSASVDFLKKLAVIKLNG
GLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEYLNRTYNVNVPFVLMNSFNTDEDTQSII
KKYEGHNIDILTFNQSRYPRILKDSLLPAPKSYQAPITDWYPPGHGDVFESLYNSGTLDK
LLDRGVEIVFLSNADNLGAVVDMRILEHMVKNKAEYIMELTDKTKADVKGGTIIDYEGRA
RLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMNLRAIKRVVEHNELEMEIIPNDKSIPAD
RKGEADISIIQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLMLVKSDLYTLQHGQL
VMDPNRFGGAPLIKLGSDFKKVSDFQKRIPSIPRILELDHLTISGAVNLGRGVTMKGTVI
IVATEGSTIDIPPGSVLENVVVQGSLRILEH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcccagttccctctgaggagtactccccgctgactgatggtgaccatggtgac
cgcgatgtcaaggccttcgagaatgcatctacaaacgttgcagcgtcacagatgcgcaat
gccctcaatgccctcgccgataccgtcacggatcccaaggaaaagcagcgttttgaagca
gagatggacaacttcttttctctatttcgacgatacctaaacgacaaggcaaaaggcaac
gtcctgtcctgggatcgcattgctcccccacaaccaagccaagtcgtcgagtacagtgaa
ctggggaattcggcttcagtcgactttttgaagaagttggccgtgatcaagctgaatggt
ggcttggggacgtcgatgggctgtgttggacccaaatccgtcatcgaggttagagagggc
atgtccttcttggacctatctgtccggcagatcgagtacctgaaccgcacgtacaacgtt
aatgtgccgtttgtgcttatgaactccttcaataccgacgaggacacccagtcgataatc
aaaaagtacgagggacacaacattgacatcctgacgttcaaccagtctcgatatccccgc
attctcaaggattcgttattgcctgcccccaaaagctatcaggcccccatcacggactgg
tacccccccggtcatggtgacgttttcgagtcactctataactctgggacgttagacaaa
ctcttggaccgaggagtggagattgttttcctttccaacgcggacaacttgggtgctgtt
gtcgacatgcggattctggaacacatggtgaagaacaaggcggaatatataatggaacta
actgacaagactaaagccgacgtcaagggtggtaccatcatcgactacgagggccgggcc
cgcctgctcgaaatcgcccaggtgcccaaggagcacgtgaacgaattcaaatccatcaag
aaattcaaatatttcaacaccaacaatatctggatgaacctgcgcgccatcaagcgcgtc
gtggagcacaacgagctcgaaatggaaatcatccccaacgacaagtccatccccgccgac
cgcaaaggcgaggccgacatctccatcatccagctcgaaaccgccgtcggcgccgcgatc
cgccacttcaaaaacgctcacggcgtcaacgtcccgcgtcgccgcttcctgcctgtcaag
acctgctccgatctcatgctggtcaagtccgacctgtacacgctccagcacgggcagctg
gttatggaccccaaccggttcggcggcgcgccactaatcaagctaggaagtgatttcaaa
aaggtttccgatttccagaagcggattcccagcatcccgcggatcctggagctcgatcac
ttgacgatcagcggcgcggtcaatctcggtcgcggtgtgacgatgaagggcactgtgata
atcgtggcgacggagggcagcacgattgatataccccccggctccgttcttgagaacgtc
gtcgtgcagggaagtttgaggatcttggaacactaa

DBGET integrated database retrieval system