KEGG   Ajellomyces capsulatus: HCAG_04549Help
Entry
HCAG_04549        CDS       T02229                                 

Definition
repressible alkaline phosphatase precursor
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aje  Ajellomyces capsulatus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aje00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 495 aa AA seqDB search
MDDILVLDQHHIGSSRTRSSSSLVTDSAAGATAFSCGMKSYNGAISVLPDKSPCGTILEA
AKLAGYMTGLVVTTRVTDATPACFASHANMRSYEDLIAEQEIGNYPLGRMVDLIMGGGRC
HFIPNSADGSCRRDDKDVVQMAKANGFSYIHDRAGFDSLQMGSNVTLPLLGLLAAKDIPF
EVDRSQMTDVYPSLEDMTRTALKALSEATKDSEKGFFIMIEGSRIDHGGHGNDPVAQVHE
VLAYDKAFSAALEFLKTDSTPGVLVATSDHETGGLSIAKQLHADYPEYLWYPGVLGNASH
SSEYLGNALDHYLANEGKNADDLNRRNYIRNKLLGDGLGIHDATNAEVQKLMDGGGAYAF
ADMVSRRAQIGWSTHGHSGVDVNIYASSAHDAMPLVGNHENTEVGLFLQKYLSLDLHNVT
KRLKDTKSSPHVSGDGSGNLYPWMGEPLDDGVVVDELDRYHGDFKRRIRGESADQFLLDH
EDLESEGCSCGSTKH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggacgatattcttgttctcgaccagcaccacataggttcatcaagaacccggtcctca
tccagtctcgttaccgactctgcggccggtgcgactgcgttctcgtgtgggatgaaaagc
tacaatggcgcaatttctgtccttccggataaatccccgtgtggtaccattctcgaggca
gcgaaattagccggttatatgactggtttagtcgtaacgacccgcgttactgatgctacg
ccagcttgctttgcgtctcatgctaacatgcgatcctacgaagatctcattgctgagcag
gaaatcgggaactaccctctaggtcggatggttgatttgatcatgggaggcggacgatgt
cactttataccaaactcagcagacggtagctgccgtcgcgatgataaagatgtggtacag
atggctaaagctaatggattctcgtacattcatgatcgggcgggattcgacagtcttcag
atgggcagcaacgtcactctacccttactcggccttctggctgctaaggacattcccttc
gaagtggaccgcagccagatgactgatgtttacccttctcttgaagatatgacacgaaca
gccctaaaggccctgagtgaagctacgaaagatagcgagaaaggttttttcattatgatt
gagggctcgaggatagatcatgggggccatgggaatgaccctgtcgctcaagtccacgaa
gttctagcttatgataaagctttttctgcggcgttagagttccttaagactgattccacc
cctggtgttcttgttgccacatcagaccacgagacaggcggcttgtctattgcaaaacag
ctacatgctgattaccccgagtatctctggtatcctggtgttctcggaaatgcgagccac
tcgtctgaatatctcggaaatgctcttgatcattatctagctaatgaaggcaaaaacgct
gatgatctaaaccgccgtaattatatccgcaacaagctgctcggagacgggttaggcatt
catgatgcgacgaacgctgaggtccaaaaactcatggacggtggtggagcctatgctttt
gccgacatggtcagtcgacgggcccagattggctggtcgacgcatggccattcaggtgtc
gacgtcaatatttatgcctcatcagcacacgacgcaatgcccctcgttggcaaccatgaa
aataccgaggtcggcttatttctccagaaatacctctcacttgatctacataatgtcacc
aagcgcttaaaggataccaagtcatctccacacgtcagcggtgatgggagtggtaacctg
tacccctggatgggcgagccgctggatgatggtgttgtcgtcgatgaacttgatagatac
catggcgatttcaaacgaaggatacggggcgagagcgccgatcaatttttgcttgatcat
gaagatctggagagtgaaggttgcagttgtggttcgacgaagcactag

DBGET integrated database retrieval system