KEGG   Ajellomyces capsulatus: HCAG_04802Help
Entry
HCAG_04802        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
aje  Ajellomyces capsulatus
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    HCAG_04802
Enzymes [BR:aje01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HCAG_04802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 485 aa AA seqDB search
MFRKSSAILLVAAFLEALPASVGGFYTKNSPVLQVDESNYDNLIAKSNHASIVEFYAPWC
GHCQNLKPAYEKAAKSLQGLAKVAAVNCDDDSNKPFCGRMGVKGFPTLKVITPSKHPGKP
LVEDYQGARTAKAIVDFVVDRIPNHVKRIKDKELDSWLKEANDTAKAILFTEKGTTSALL
RSLAIDYHGSISVAQIRSKETAAVEMFGITKFPTLALLPGGSKEAIIYDGEMKRNPMFEF
LNQVAEPNPEPVQAKSKQTTKAGKATTSTSTPSDSDATTSSTATESPESSSKDPSSTSPK
PRPIPSIFSDSMLRESCLAPKTGTCVLALVGVPEDLSTDSVPSTTVLQALGSLAEISQKH
SLRKSHLFPFYTVPSSLKDVDMLKTKLDLTRDIDIDVIAVNVKRGWWRRYDAGDDGDWSV
AKLEAWIDAIRMGEGTKRKLPEGMVPDEEEKGGPEDGAEREQKKESGEEPEQKPVKEEHT
GHSEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaagagctccgccatcctgctggttgcagcatttctagaggcattgccggca
agcgttggtggcttctataccaaaaactctccagttcttcaagtggatgagagcaattat
gacaacctgatcgcgaagtcaaaccatgcttcaatcgtagaattctacgctccatggtgt
ggacattgccagaacctgaagccagcatacgaaaaagcggccaagagtcttcaaggacta
gctaaagttgctgctgttaattgcgatgacgattcgaacaaaccattctgtggcaggatg
ggagtcaaagggtttcctacacttaaagtgataacgccatcgaagcacccaggaaaacca
ctagtcgaggattaccaaggcgccagaacagcgaaagccatagttgacttcgtagttgac
aggataccaaatcatgtcaaacgaattaaagataaagaactcgatagttggctgaaggaa
gccaatgacactgcgaaggctatcctattcacggagaaaggcactactagtgcacttctc
cgatcgttggctatagactatcatgggtctatcagcgtggcccaaattcgtagcaaagag
accgcagctgtggaaatgttcggtatcaccaaattccctacacttgcactacttcccggt
ggaagcaaggaagctataatctacgatggagagatgaaaagaaaccccatgttcgaattc
ctcaaccaagtagccgagcctaatccagagcccgtgcaggccaaatccaagcagaccacg
aaagctggcaaggccaccacctccacttccacgccctctgatagcgatgccactacttca
tccacagccaccgaatctcccgaatcgagttctaaagatccatcttctacatcacccaag
ccccgtcctatacccagtatattcagcgactcaatgctgagagagtcttgtcttgctccg
aaaactggaacttgtgtcctcgcactcgtgggagtgcctgaggatctatcgactgactcc
gttccttcaacgacagtactccaggcgcttggcagccttgctgagatttcccagaaacac
tctttgagaaaatcacacctgtttccgttctacactgtgccaagtagtttgaaggatgtt
gatatgttaaagactaagctggatctcacacgtgacatcgacattgatgtcatcgctgtt
aatgtcaaacgaggttggtggcgacggtatgatgctggggacgatggcgactggagcgtt
gccaaacttgaggcatggattgatgctattcgtatgggtgaagggaccaaaaggaagctg
ccagagggtatggtacctgatgaggaggaaaagggagggcctgaggacggagccgagaga
gaacagaagaaagaatctggagaggagccagagcagaaacctgtcaaggaagagcatact
ggccacagtgagctgtga

DBGET integrated database retrieval system