KEGG   Ajellomyces capsulatus: HCAG_04928Help
Entry
HCAG_04928        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
aje  Ajellomyces capsulatus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HCAG_04928
   00240 Pyrimidine metabolism
    HCAG_04928
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HCAG_04928
   03410 Base excision repair
    HCAG_04928
   03420 Nucleotide excision repair
    HCAG_04928
   03430 Mismatch repair
    HCAG_04928
   03440 Homologous recombination
    HCAG_04928
DNA repair and recombination proteins [BR:aje03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      HCAG_04928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 218 aa AA seqDB search
MPATTRRRSGNSNQSTLSFGAQHKVSQPTTISSSLAGKKGKKTTDVSSPAGELRRRSASG
SVSPVSVTTPVVEPPSPKANVQCPAEIESEQKPVASSSRSENIIAEQARVELRLRKSEED
RQAEELTEEDIRKYWENEEAGRLAPRVHQEHLTVHEKILRHFDLSNQYGPCIGIARLKRW
RRAQMLNLNPPIEVLAVLLKDEAKGVANEKAYIDELMS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaccacccgccgccgctccggcaactcaaaccaatccaccctctccttcggc
gctcaacacaaagtctcccagcccacgacaatctcttcatcactcgccggcaaaaagggt
aagaaaacgacagatgtcagctccccagccggagagcttcgccggcggagcgcctctggt
tcagtatcaccggtatccgtaaccactcccgttgttgaaccaccatctccaaaagccaat
gtccagtgtcccgctgagatcgagtcggagcaaaagcccgttgcgtcatcgtcgcggagt
gaaaatatcattgctgagcaggcgagggttgaattacggctgcggaaatccgaggaggat
aggcaggcggaggagctgacggaggaggatataaggaaatattgggagaacgaggaggcg
gggaggcttgcaccgagggtacatcaagagcacctgacggttcatgagaagatcctacga
cattttgatttgtctaatcaatatgggccctgtatcgggattgcacgactaaagcgctgg
aggcgagcgcagatgctcaacctgaatccacccattgaggtccttgctgtgctgttgaag
gatgaggcgaagggcgttgcgaatgagaaggcgtatattgacgaattgatgtcgtag

DBGET integrated database retrieval system