KEGG   Ajellomyces capsulatus: HCAG_04986Help
Entry
HCAG_04986        CDS       T02229                                 

Definition
glutathione peroxidase family protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aje  Ajellomyces capsulatus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aje00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:aje00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 190 aa AA seqDB search
MASATSFYDFSPADKKGEPFPLSSLKGKVVLVVNTASKCSLAPQFKGLESLYHSINDAHP
DKFAILGFPCNQFASQDPGSNDEIQTFCAVNYGVTFPILAKVDVNGDKAEPLWKWLKSEM
PGLMGMKRVKWNFEKFLVSADGKVVNRWSSVTKPESLKGAIEKEIEKSKKVDSAPALETA
AEVPTEPQAQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgccacaagcttctatgacttcagccctgctgataaaaagggcgaaccattc
cccctctccagcctcaaaggcaaggttgtcctcgtcgtcaacaccgcttccaagtgcagc
cttgccccgcaattcaagggcctcgagtccctctaccactccatcaacgacgcccaccca
gacaaattcgccatcctcggcttcccctgcaaccaatttgcttcccaggacccaggctcc
aacgacgaaatccaaaccttctgcgccgtcaattacggcgtcaccttccctatccttgcc
aaagtcgacgtgaatggcgacaaggccgagccattgtggaagtggctgaagtccgagatg
ccgggcttgatgggcatgaagcgcgtcaagtggaactttgagaagttcttggtcagtgcg
gatgggaaggtcgtgaatcgctggtccagtgtgacgaagccggagtcgttgaagggggcc
atcgagaaggagattgagaaatccaagaaggtagacagcgctcccgcgcttgagactgcg
gcggaggttcccacggaaccccaggcgcagtag

DBGET integrated database retrieval system