KEGG   Ajellomyces capsulatus: HCAG_04986Help
Entry
HCAG_04986        CDS       T02229                                 

Definition
glutathione peroxidase family protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aje  Ajellomyces capsulatus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HCAG_04986
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HCAG_04986
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HCAG_04986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 190 aa AA seqDB search
MASATSFYDFSPADKKGEPFPLSSLKGKVVLVVNTASKCSLAPQFKGLESLYHSINDAHP
DKFAILGFPCNQFASQDPGSNDEIQTFCAVNYGVTFPILAKVDVNGDKAEPLWKWLKSEM
PGLMGMKRVKWNFEKFLVSADGKVVNRWSSVTKPESLKGAIEKEIEKSKKVDSAPALETA
AEVPTEPQAQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgccacaagcttctatgacttcagccctgctgataaaaagggcgaaccattc
cccctctccagcctcaaaggcaaggttgtcctcgtcgtcaacaccgcttccaagtgcagc
cttgccccgcaattcaagggcctcgagtccctctaccactccatcaacgacgcccaccca
gacaaattcgccatcctcggcttcccctgcaaccaatttgcttcccaggacccaggctcc
aacgacgaaatccaaaccttctgcgccgtcaattacggcgtcaccttccctatccttgcc
aaagtcgacgtgaatggcgacaaggccgagccattgtggaagtggctgaagtccgagatg
ccgggcttgatgggcatgaagcgcgtcaagtggaactttgagaagttcttggtcagtgcg
gatgggaaggtcgtgaatcgctggtccagtgtgacgaagccggagtcgttgaagggggcc
atcgagaaggagattgagaaatccaagaaggtagacagcgctcccgcgcttgagactgcg
gcggaggttcccacggaaccccaggcgcagtag

DBGET integrated database retrieval system