KEGG   Ajellomyces capsulatus: HCAG_05084Help
Entry
HCAG_05084        CDS       T02229                                 

Definition
similar to malate synthase 2
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
aje  Ajellomyces capsulatus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCAG_05084
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HCAG_05084
   00630 Glyoxylate and dicarboxylate metabolism
    HCAG_05084
Enzymes [BR:aje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     HCAG_05084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 539 aa AA seqDB search
MAAVDTLLKDVAILGPLNDQTRKILTKEATAFLALLQRTFNPTRKALLQRRIDRQAELDR
GTLLDFLPETKHIRDNDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNSDVYTYMADFE
DSSAPTWENMVNGQVNLYDAIRRQVDFKQGGKEYKLRTDRKLPTLIARARGWHLEEKHMT
VDGDPMSASLFDFGLYFFHNAKELVSRGAGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRATVLIETISAAFEMDEIIYELRDHSSGLNCGRWDYIFSFIKKFRQNPNFVLPDR
SAVTMTVPFMDAYVKLLIKTCHRRGVHAMGGMAAQIPIKDNPKANDAAMASVRADKLREV
RAGHDGTWVAHPALAKIATDVFDQYMPTPNQLFVRREDVHITANDLLNTNVPGSITEDGI
RKNLNIGLSYMEGWLRGIGCIPINYLMEDAATAEVSRSQLWQWARHNVTTAEGKRVDKSY
ALKLLQEQADELANKGPKGNKFQLAARYFAGQVSGEDYADFLTSLLYNEISAPGSAAKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgtcgacaccctcctcaaggacgtggccatcctcggccctctgaacgaccag
acccgcaagatcctcaccaaggaagccaccgcgtttctcgccctgctgcaacgcactttc
aatccaaccagaaaagctctcctccagcgacgcattgaccgtcaagcagagctcgaccgg
ggcactctcttagacttcctcccagagaccaagcatatccgtgataatgatgcgtggaag
ggagccccgcccgcgccgggcctggttgaccgccgggtggaaatcaccggcccaacggac
aggaaaatggtggttaatgcgttgaattcggatgtgtatacttacatggctgattttgag
gactcaagtgctcccacttgggagaacatggtcaatggccaggttaacctgtacgatgcc
atccgcagacaggttgatttcaagcaaggcgggaaggaatacaagctgcgcaccgacagg
aagctccccaccctcattgcccgcgcgagaggctggcaccttgaggagaagcatatgacc
gtcgatggcgatcccatgtccgctagtcttttcgatttcggcctctatttcttccacaat
gcaaaggagttggtcagccgaggtgctgggccttacttctatctccccaagatggaatcc
cacctcgaggctcgtttgtggaatgatgttttcaatcttgctcaggattacattggcatg
cctcgcgggactatccgcgctaccgttttgattgagactatctctgctgcctttgagatg
gatgagatcatctacgagctcagagaccacagctctggcttgaactgcggtcgatgggat
tacatcttctcctttatcaagaagttcagacagaaccccaatttcgtcctcccagaccgc
tcagctgtcaccatgactgttccattcatggatgcctacgtcaagctcctcatcaagacc
tgccaccggagaggcgttcacgctatgggtggtatggccgctcaaatccccatcaaagac
aaccccaaggccaacgacgcggccatggccagcgtgcgggccgacaagctccgtgaggtg
cgtgcgggccacgacggaacctgggtcgcccatcccgcattggccaagattgccacagac
gtcttcgaccaatacatgcccaccccgaaccagctgttcgtccgcagggaggatgtgcac
atcaccgccaacgacctcttgaataccaacgtccccggcagcatcactgaagatggcatc
cggaagaacttgaacatcggattgtcctacatggagggctggctccgtggaatcggatgt
atccccatcaactatctcatggaagatgccgccactgccgaagtaagccgcagccagctc
tggcaatgggccagacacaacgtcaccactgcggagggcaagcgagtcgacaagagctat
gcactcaagctgctgcaagagcaggccgacgagctcgcaaacaagggccccaagggcaac
aagtttcaacttgccgctcgctattttgccggtcaagtttctggcgaggattatgctgat
ttcttgacatcgctactctacaacgaaatctccgcccccggcagcgctgccaagttgtaa

DBGET integrated database retrieval system