KEGG   Ajellomyces capsulatus: HCAG_05089Help
Entry
HCAG_05089        CDS       T02229                                 

Definition
mitochondrial 2-methylisocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
aje  Ajellomyces capsulatus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCAG_05089
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HCAG_05089
Enzymes [BR:aje01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     HCAG_05089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 600 aa AA seqDB search
MIRNAARRLPRQLRPFSRPPSLSYTAARTFSCGCPWMASQLPPVNPPVSVAHASDSFQLL
PSSEKSGPAEDELFEEQVQAVTKWWNTPRFEGIKRPYSAEAVVSKRGSLQQTYPSSIMAR
KLFNLLNERAKAGKPVHTLGAIDPVQMTQQAPNQEVLYISGWACSSLLTTTNEVSADFGD
YPYNTVPNQVQRLFKAQQMHDRKEWDARRKLSAEQRRTTPYTDFMRPIIADGDTGHGGLT
AVLKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPIAEHINRLVAARFQWDIMGTE
NLLIARTDSESGKLLSSTIDVRDHEFILGVTENSSPLAETLQRMELDGAPGSEIDKFESQ
WVKNHKLVTYDEAVEQHLKSEGASQSSIDAYKKQVTENRDMSINERRALAGKYTKSPVFW
SWDIPRTREGYYHYLAGNAAATKRAINFAPYADLLWVETGDPSVEKAASFAGDIRAKYPG
KKLVYNLSPSFNWMGHGFTEATLKSFIWDIAQHGFTLQLISLAGLHTNATMTSELSRKFK
DDGMLAYVNLVQRREKEMGVDVLTHQKWSGAPYMDGIVGSILSGSSSNKSMGEGNTEDSF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcaacgctgctcgccgtttgccccgacaacttcgtccattctctcgccctccc
tctctctcctatactgccgcccgaacgttctcctgtggctgcccatggatggcgtcccaa
ctgcctccagtcaacccacccgtctcagtggcacacgcatccgactcattccagctacta
ccttcctctgaaaagtcagggcctgctgaagatgagctttttgaagagcaggtacaagct
gtgaccaagtggtggaacacaccgcgctttgagggtatcaagcgtccatactcagcagag
gcggttgttagcaagcggggttcgctgcagcagacttatccaagctcgattatggccaga
aagctattcaatttgttgaatgagagggcaaaggctggaaaacctgtacatacccttggt
gctattgatcccgtccagatgacacagcaagctcccaaccaagaggtgctgtatatatca
gggtgggcgtgttcatccctcctcaccaccacaaatgaagtatccgcggactttggagac
tacccttacaacacagtcccaaaccaggtccagagactcttcaaggctcagcaaatgcac
gaccgcaaagaatgggatgcgagaaggaagctttctgcagaacagcgcaggacgacgccg
tacaccgatttcatgcgaccaataatcgctgatggcgatacagggcacggaggccttacg
gcagtattgaaactggccaaactctttgccgaaaacggagccgctgctgtccatttcgag
gaccagcttcatggaggcaaaaaatgcggccatcttgccggcaaggtgcttgtccccatt
gccgaacacatcaacagactcgtcgccgcaagattccaatgggatattatgggaaccgaa
aaccttctcatcgcccgaacggactcggaaagcggcaaactcctaagcagcaccatcgat
gtccgggaccatgagttcatcctcggtgtgactgaaaactccagtccgctcgccgaaaca
ctacagagaatggagttggacggagcccccggctctgagatcgacaaattcgagtcacaa
tgggttaaaaatcataaacttgttacgtacgatgaagctgtcgagcagcatcttaaatcc
gagggagcctcacagtcatccattgacgcctataagaagcaagtaaccgaaaaccgggac
atgtcgatcaatgaacgacgagctcttgcaggcaagtacacaaagtcgcccgtattctgg
tcttgggatattccccggactcgggagggttactaccattaccttgccggtaatgctgcg
gccacgaaacgtgcgatcaattttgccccctacgctgatttgctctgggttgaaactggc
gacccgagtgttgagaaggcggcgtcgttcgcaggagacatccgagcaaaataccctggc
aaaaagctggtgtacaatctcagcccttcttttaattggatgggacacggtttcaccgaa
gccactctcaagtcgtttatttgggatatcgctcagcatggtttcacccttcaactcatc
tccctcgccggtctccacactaatgctaccatgacaagtgaactttctcgcaaattcaaa
gacgatggcatgttggcttatgtgaacctcgtccaaaggcgagagaaggagatgggggtt
gacgtcctcacgcaccagaaatggagtggcgccccctatatggacggcattgtcggctct
atcctcagcggcagcagctctaacaagagtatgggtgaagggaatactgaagattctttc
taa

DBGET integrated database retrieval system