KEGG   Ajellomyces capsulatus: HCAG_05249Help
Entry
HCAG_05249        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aje  Ajellomyces capsulatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HCAG_05249
Enzymes [BR:aje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HCAG_05249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 267 aa AA seqDB search
MMNTPSSTPAKTPIFLLKTKSTPHDGYEEYFSASGQYDPIFVPVLEHRFREASLRRVRDL
FVSGNIGKKYGGLIFTSQRAMEGFARVITNEVGENASTKASESLLLYSVGPATYRSLNTL
RESHLPHSELVGRDAGTGEKLAHIILDHYNANYGNRRPTTDPETKVDGDGSAKTKTGGSN
DNKLPLLFLTGEQHRDIIPKTLMGDKLPLERRIQVEELIVYETGVMESFEDMFAAALRAA
RARRKLEGRGGGGANGREWIGMGYPHL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacactccctcaagcacccccgccaaaacccccatcttcctcctgaaaaccaaa
tcgactccccacgacggatacgaagaatatttctccgcatccggccagtatgaccccatc
ttcgtcccggtcctcgaacacaggtttcgtgaggcaagtctgcggagggtgagggacctg
ttcgtctccgggaatatagggaagaaatatggggggttgatatttacgagtcagagagct
atggaggggtttgcgagggttatcacgaatgaagtgggggaaaacgcatctacaaaggcc
tctgaatccctactcctctacagcgtcggacccgcgacctaccgctctctgaatacatta
cgcgaatcacacctcccccactctgaactcgtaggccgcgatgcgggtacgggcgagaaa
ctcgcgcatatcatcctcgaccactataatgccaattacggcaatagaagacctaccacc
gatcccgaaacaaaggtagatggtgatggcagcgcaaagacaaaaacgggagggagcaac
gataacaaattaccccttttattcctcacgggagagcagcaccgagatatcatccccaag
acgctcatgggggacaagcttccgctggagaggaggatacaggttgaggagttgatcgtc
tatgagacgggggttatggagtcgtttgaggatatgttcgcggctgcgctgagagctgcg
cgggcgaggagaaagctcgagggcaggggaggaggtggtgcgaacgggagggaatggata
gggatgggatatccacatctatga

DBGET integrated database retrieval system