KEGG   Ajellomyces capsulatus: HCAG_05250Help
Entry
HCAG_05250        CDS       T02229                                 

Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     HCAG_05250
Protein kinases [BR:aje01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   HCAG_05250
Exosome [BR:aje04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HCAG_05250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 367 aa AA seqDB search
MSLSVRSCLNTITMVQPSTSQGGSRKISFNVSDQYDIQDVIGEGAYGVVCSALHKPSSQK
VAIKKITPFDHSMFCLRTLREMKLLRYFNHENIISILDIQKPRSYESFTEVYLIQELMET
DMHRVIRTQDLSDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGL
ARSAASTDDNSGFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPG
KDYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSLPFKKKIPLKALFPKTSDLALDLL
EKLLAFNPVKRISVEEALRHPYLEPYHDPEDEPTADPIPEEFFDFDKNKDSLSKEQLKVL
IYEEIMR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtctctatcggtgcgctcatgtttgaacaccatcaccatggtccagccatcaacttct
caaggagggtcaaggaagatatcattcaatgtttccgaccagtacgatatacaggatgtg
attggggagggcgcatatggagttgtctgctctgcgcttcataaaccctcgagccagaag
gtcgccataaagaagatcacaccattcgatcattccatgttttgcctgcgcacgctgcgc
gagatgaagctccttcgatacttcaatcatgaaaacatcatctcgattctagacatccag
aaaccccgaagctacgaaagcttcactgaggtgtacctcattcaggaactcatggagacg
gatatgcaccgcgtgattcgcacccaggacctttccgacgaccattgccaatactttatc
tatcagaccctgcgagccctgaaagctatgcactctgcaaatgttcttcatcgtgacttg
aaaccctcgaacttactcttaaacgcaaattgcgacctgaaagtttgcgacttcggtcta
gcccgttctgccgcttccacggacgacaactctgggtttatgacagaatatgtggccact
cgttggtaccgtgcaccggaaatcatgttgaccttcaaagagtacaccaaggctattgac
gtgtggagtgttggttgcatattggcggaaatgttgagcgggaagccgttgttccccggc
aaggattatcaccatcaacttaccctcatcctggatgtcctggggacaccaaccatggaa
gactattatggcatcaagtctcgtcgtgctcgggaatatatccgatccctcccttttaag
aagaagatacccctaaaggccctcttccccaagacctccgatctggccttggacctgctc
gagaaactccttgcattcaacccagtaaaacgcatcagtgtcgaagaagctttgcgccat
ccttacctggagccgtatcacgatccagaggatgaaccaacagctgatccgatccccgaa
gaattctttgatttcgacaagaataaagactcccttagcaaggagcagctgaaagttctt
atctacgaagagatcatgcggtag

DBGET integrated database retrieval system