KEGG   Histoplasma capsulatum: HCAG_05310Help
Entry
HCAG_05310        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25 [EC:3.4.19.12]
Organism
aje  Histoplasma capsulatum
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 1300 aa AA seqDB search
MSHMSLPQGPGKTTPRFIQDVLSYDPANPPSSSFNLLTQFPPPFHDPDNYPELISPKACP
HQYITKANQTELPPEGFQAGLRTPFKVSAVCLICRYHLEIKITHTTEASHCPSQLHHIVY
SHSDNRQDSNPFRQKGQRLEAHYFRCSYPTCAAAISLKLLSPILTPHWVDLLTNTELLKV
RTDAAMEAYPERLEGHSRPLPITVLTNLRTYIENALHDSQRSKSISKSNKRFVVCFGVDG
QPCHELLEFLEFQPREDVWEPPRPSTSDLVPYQNILNIFLDNVSSELLAFIYRRPAYEKE
GQQLGTPLDPAIGKFNQLLGSSTFNPEIRRAPYYEDLGVTDDMSADLIIEAYNRQIETDP
GRSPYYLRCLRHIGEWRRVTDGEKINNLVTLECSGSRYADDDIPRAYKYFQLDYGNRNLT
DDDIIGSFFARLRDTANDTETRRQLWRIGESRGSEKIKSVAEERLSTVEQALVYLGVEND
TSDDFIVSMYAAKVNDQPATKELARKAIALIAEARNSDSLKYFLTTGETAATEMDVGEAF
RLLQIPDRTVDDAAILAAFSVCCSEAPGQIEAYRRALGVIGREKGSALISSTLGQESTQA
NRVLKEWPVGLQNIGNTCYLNSLLQFYFTVTPFRKMVIHFDDYKMPLDETSLERKKIGSR
KVSIAEIERSQKFLLELQLLFKKMITSPTSSVIPEQELARLTLISSSNEAAIRRKSLITS
SRPNLGEINGMPVLGPLGPITTVTTEVPKDVSAGASNQKVEPSDGDSDITLVSLTAQADN
EELSIDNKENVGPAPQDSSIDVKEIDDSNHTSAATGDSIRPPSSMGPPSRPPPVPPRPIA
LRQEPVVNYQQQLRDEVELGAQQDVTEVINNVLFQTQCAVKPIRFDQDGEQLDVVTDLFY
GKTVSYITAENGVRSKEESWCDIKIDVATGSKNIYSAIDGAFDVQKVEVDGAEVEQYGTI
SKLPPILQIQVQRVQFDQVKKASFKSTHHLALKETIYLDRYMDSNKHNLDERRRECWRWK
DELRKLRARKAELIDTESWTCLPDVFTETKVRVQSLMSIGDDPELADEALELDDTILYRL
TAVQEMVQDEIKCLEAREKDLIALIESQFTDLRHLPYRLYAVFMHHGSVEFGHYYIYIFD
YDKNIWRKYNDGEVTEVQSKSEIFESQNLTNPPTPYFLIYVNDRMKDRLVKPVNREIEDV
SPTGIPSQPAPAPAPSVVVRGQQANGPGPSQTSTSPSGEIEMEEPPAYNEIENVHAGAVV
MTEAEIAVSSSQPRNRLKRKVDGENHTDDTPNPLDPNATG
NT seq 3903 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatatgtctcttccccagggacctgggaaaaccactccccgatttatccaagat
gtcctttcttacgaccctgcaaaccctcccagctcatccttcaacctcttgactcaattt
ccgcctccttttcacgatcccgataactacccggaactcatctcgccgaaggcttgtccc
caccaatacatcacaaaggctaaccaaaccgagcttcctcctgaaggtttccaggctgga
ctaaggactccattcaaagtgtccgctgtgtgcttgatctgccgctatcatttagagatc
aagataacgcatacaacagaagcatctcactgccctagccaactgcatcacattgtttat
tcccacagcgacaatcgccaagattcaaaccctttccgccaaaaaggccaacgattagaa
gcccattacttccgttgttcatacccgacatgcgctgctgcgatttccctcaagttactt
tccccgattttgacaccgcactgggtggacctcttgacgaacacggagctactaaaagtc
aggaccgatgcggctatggaagcgtatccggagcgactagagggccacagtcgaccattg
cccatcaccgtcttgacaaaccttcgtacttacatcgaaaatgccttgcatgacagccag
agaagcaagtcaatatctaagtcaaataagcgattcgttgtctgttttggtgtggatggt
cagccttgccatgagcttttggaattcctagaatttcaacccagagaagatgtttgggaa
cctccgcgtcctagcacatccgacctcgtcccgtatcaaaatattctaaatattttcctt
gacaacgtgtcaagtgagcttttagctttcatctaccgaagacccgcctacgagaaagaa
ggccaacaactgggaacacccctcgaccctgccattggcaagttcaatcagctccttggt
tcatcgactttcaatccagagataagaagggcaccatattacgaggatcttggagtgact
gatgacatgtccgcggatcttattatcgaggcgtacaaccgacagattgaaaccgatcct
ggacgaagtccctattatctcagatgtttgcgacatattggcgaatggagacgcgtcaca
gatggagagaaaatcaacaacttggtcactcttgaatgtagtggttctcgatacgcggac
gatgatatcccacgtgcgtacaagtacttccaactggattatggaaaccgaaacttgaca
gatgatgacatcattggctctttctttgctcggcttcgcgatactgctaacgacacggaa
acgagacgacaactttggaggattggagaaagccgaggaagtgagaaaatcaaatcagtg
gctgaagagcgtttatctactgtagagcaggcgctggtataccttggagtagaaaatgat
acctctgatgattttattgtttctatgtatgccgcaaaggttaatgatcagccagctact
aaagagctagctcggaaggcaattgccttgattgccgaggcgcgcaattccgattctctg
aagtactttttaactactggtgaaacagccgccacagagatggatgttggagaggcgttc
cgtctccttcaaatacctgaccggactgtggatgatgctgcgattcttgctgcattttcc
gtttgttgctcagaggctccgggccagattgaagcgtatagacgagctcttggtgttatc
ggcagagagaaaggaagtgcgttgatcagcagcactctcggccaagaatcgacgcaggca
aaccgtgtactgaaagaatggcctgtcggtctccaaaatatcggcaacacctgttacttg
aacagtttactccaattttacttcacggtgactcctttccgtaagatggttattcatttt
gatgactataagatgcctctcgacgagacaagtcttgagaggaaaaagattggatcccga
aaagtctccattgctgagattgagagatcccaaaaatttctcctggaactccaattattg
tttaaaaaaatgataacatcgcctacttcctccgtcattcctgagcaggaacttgctcgg
ctaactcttattagctcttcaaacgaagcagccatccggaggaaatccttgatcacgagc
agtcggcccaaccttggtgagataaatggcatgccagttttaggcccattaggacccata
acaactgtcactacagaagtaccaaaagatgtgtcagcaggtgcaagtaatcagaaagtt
gaacctagtgatggggacagcgatataacacttgtttcattaacggcacaagcagataat
gaggaactgtcgatcgacaataaggaaaatgtagggccggcacctcaggattcttctatc
gacgtgaaagaaatagatgattcaaaccatacgagcgccgctactggtgattctatacgc
ccgccgtcgtccatgggccctccgagcagaccccctccggttccccctcgaccaatagcc
ttacggcaggagccagtagtcaattaccaacagcaacttagggacgaagttgagctaggg
gcacagcaggatgttacggaggttattaacaacgttcttttccagactcagtgcgctgtc
aaacctattagattcgatcaagatggagagcagctcgatgttgtcacagatttattttat
ggcaagaccgtttcctacattacggcagaaaatggggttcggtccaaggaagagtcttgg
tgtgatatcaagatcgacgttgccactggatcaaaaaacatctattctgcaatcgacggt
gcttttgatgtacaaaaggtagaggtagatggtgctgaggtggaacaatacggcaccatc
agcaagttgcctccaattctccagatccaagtccaacgtgttcagtttgaccaagtcaag
aaggcgtcgtttaagtcgactcatcacctggcgttgaaggaaacgatatatttagacagg
tatatggacagtaataagcataatctggatgaaaggcgccgtgaatgctggcgttggaag
gatgagctccgcaaactgagagcgcgtaaagctgagcttattgatacagagagttggacg
tgcttaccggatgtcttcacggagacaaaggtgcgcgttcaaagcctgatgagtatagga
gacgatcctgaattggcagatgaagcactggagctcgatgacactattttatatcgtctt
acagcagttcaagagatggtccaggatgaaattaaatgcctcgaagcacgagaaaaggat
ttaatcgcgttgattgagtctcaattcaccgatcttcgccatctcccttatcggctatat
gctgtttttatgcaccacggctctgttgagtttggtcattattatatttatatttttgac
tatgacaagaatatatggcgaaagtacaacgacggcgaggttacagaagtccaaagcaaa
tccgagatatttgaaagccaaaatttaaccaatccacctacaccgtacttcctcatatac
gtcaacgatcgtatgaaagacagactcgtaaaacctgtcaatcgcgaaatcgaagatgtc
agtcctactggcatcccatcacagccagcaccagcaccagcaccatctgtagttgtgcgt
ggtcagcaagcaaatggccccggaccatcgcaaacgagcacttcgcccagcggcgagata
gagatggaagaaccccctgcgtacaatgagatagaaaatgtacatgcaggagcagtggtc
atgacggaagctgaaattgctgtatcttcttctcaaccccgcaaccgactcaagcggaaa
gtcgacggggaaaatcacactgacgataccccaaatcctctcgatcccaacgcgacaggc
tag

DBGET integrated database retrieval system