KEGG   Ajellomyces capsulatus: HCAG_05366Help
Entry
HCAG_05366        CDS       T02229                                 

Definition
WD-repeat protein mip1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
aje  Ajellomyces capsulatus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1331 aa AA seqDB search
MAQGAGPQQRGQGKSVRVAFGPQVDEYIPQSNNAPSPTAPGHQRARTTVAEQLQSNGRQN
SSQAPSSSADGNKGTASPAVTRNLRPIPALIRAKSEHFPKFGVENGAPHSDDEDFQLRHG
WHEEYTSSEYLKILNSSFYMYFTEKRHETSGIPRDPAGSWPSQDWRMRDRLKTVSAALAI
CLNIGVDPPDVVKTNPTSKLECWVDPTSTTGAQNKVMEQIGKKLQEQYETLSLRTRYKQY
LDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTQSGELWVFNKNYTQYIPVSLYDL
QTWLAGPSLFVFDVSHAGNIVHNFQTFVEKHEKENIELRKRDPNALIQHYGDCILLAACE
RTETLPTNPNLPADLFTCCLTTPIEIALRYFILQNPLHTNISIDDFRVPGRLQDRRSPLG
ELNWIFTAITDTIAWNTLPRPLFKKLFRQDLMVAALFRNFLLAERIMRAHECHPISSPKL
PETHSHPLWQSWDLAIEMVLAQLPALIEHEEGKRHYDYQHSSFFAEQLTAFEVYLSSGPT
EKNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAVHLALSIGIFPYVVKLLQSTAQ
ELKPVMVFIWARIIAVDHTVQNDLLKDNGIHYFITILSPASPIPVGNASEHRAMCAFIVA
IFCKYYPQGQNVCLAPELFEACLTHLMDVENPLLRQWSCLCLSMLWLDFPEAKWVGIRCS
APSRLCELTLDPVPEVRAAMLHALTSFIGIPELTDQVAQIEESLALTVMPMGSDGSVLVR
KELLVFLSTFVKRCQGKFLVAAYEQLLEERHILLHQTSSNKHSQMPPFPYENGVSYNTIF
GSIWKLVLMLSVDPHPEVARDAGIIVDSIHKSLLESPMKTLAKTAKDEILKLFSRVHVNK
PRRAEQADLNRSLPALPPAQSTLAPKTEGYLSLSFRRTASVAASLKNLAFGSGGNNERPQ
SPIKSASVKHRVPITPRGRAPAEWTRPPEVNDQPATSGSYRQARIPLSRGFQQRDITSIP
TIPLESKFLDWSTEYFREPQMKPNESDEPGSADYNERLWRRSRNEKIITDTQPLKERAGN
SRWDTSAALLSNPTQPTKMCFHQFEDHIAVADDRDTVCNKNAGLVFDWQQGQGKALVAGD
VKVIRVWNAATEVCTNDISARSGSCITSLTSDQVAGNIFIAGFGDGAVRVFDQRLKPTTA
MVKVWREHKQWITNIHMQRGGVRELISGSRNGEVRLWDLRMDTSIDIIHATRDTLRTLAV
HEHAPVFTIGTNRHEVKTFNTDGTYLSTYEPHFSFLHSNRSSPIMSTAFHPHRTLLACAA
LNDNHINLVSC
NT seq 3996 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaggtgctggcccacaacaacgtggccagggcaagtcggtcagagtcgccttt
ggtccacaggtcgacgagtatataccgcagtcaaacaatgcaccatcgcctactgcaccc
ggccaccagcgagcgagaacaactgtcgccgagcaacttcaaagcaatggaaggcagaat
tcttcacaagctccctccagtagtgcagatggaaataaagggactgcatcaccggctgta
acaaggaacctacgccccatacccgctcttatcagggcgaagagcgaacacttccccaag
tttggagttgagaacggggcgccccatagcgacgatgaggatttccagctaagacacggc
tggcatgaggaatacacttccagtgaatatctgaagattctcaactccagtttttacatg
tatttcacagagaaacggcatgaaaccagtggcataccgagggacccagctgggagctgg
ccaagccaagactggcgtatgagagatcgactgaaaactgtgtctgctgcgctggccatc
tgtctaaacattggtgtcgatccgcccgatgtagtgaaaaccaaccccacctcaaagcta
gaatgctgggtggatccgacttctaccacaggagcacagaacaaggtgatggaacaaatt
ggaaagaagttgcaagaacaatatgaaactctgagccttcgtacgcgttataagcaatat
ttggacccttctgtcgatgagacgaaaaaattctgcatctctcttcgtcgcaacgcgaag
gacgagcgcgtactttttcattataatggacacggggtccctttgccaacccaatcaggg
gagctctgggtattcaataagaattatacccaatacatcccggtttcattgtacgatttg
cagacttggcttgctgggccaagtttgttcgtgtttgacgtatctcatgctggcaatatc
gtccataacttccaaacatttgtagagaagcacgagaaggaaaatatcgaacttcgcaaa
cgagatccaaatgcacttatccaacattatggcgattgtattttactcgctgcctgcgag
agaaccgaaacccttccaactaatcccaacctccctgctgatcttttcacctgctgctta
actaccccgatcgagattgcgttgagatattttattttgcagaatcctttgcacaccaat
atatccattgacgatttcagagtacctgggcgtctccaagacagaaggagtcctcttggc
gaattgaattggatatttaccgcaattacagatacaattgcttggaatactcttcctaga
cctcttttcaagaaactcttccgacaagacctcatggttgcagccttgtttagaaatttc
cttctcgccgaacgtattatgagggctcatgaatgccatccaatttcttcgccaaagctt
cccgaaactcactcccatcctttgtggcagagctgggatcttgccattgagatggtcctt
gctcagctcccggccctcattgaacatgaggaaggcaaacgacattacgattaccagcat
tcgtcattttttgctgaacaactcactgctttcgaagtttatctttcttcaggcccgacg
gagaagaacccgcctgatcagcttcccattgtgttgcaagtgttgttgagtcaagctcat
cgcctccgtgcgttgattctgctcagcaaatttcttgacctagggccgtgggcagtccat
ctagctctgagcatcggtatatttccatatgttgtcaaacttctacaaagcaccgcccag
gagcttaaacccgtcatggtatttatctgggctaggatcatcgctgttgaccataccgtc
cagaatgacttgctcaaggataatggaattcactatttcattacaatcttgagtcctgcg
tcccccattcctgtcggtaacgctagtgagcaccgtgccatgtgcgcatttattgttgcg
atcttctgcaaatactaccctcagggacaaaatgtttgtcttgccccggagctcttcgag
gcttgccttactcatttgatggatgttgaaaaccctctcctacgccaatggtcttgcctc
tgcttaagtatgctttggctcgacttccctgaggctaaatgggttggtattcgatgctct
gcgccatcaagactctgtgaacttacccttgaccccgttccagaggtacgagctgctatg
ctgcacgccttaactagtttcattggaatccctgagttgaccgatcaagtggctcaaatt
gaagagtccctggccctcactgttatgcccatgggttctgatggtagtgtgttagtcaga
aaggagctgctagttttcctctcgacttttgtaaagcgatgtcagggcaaattcctcgtc
gctgcatatgaacagctacttgaagaacggcacattttattacatcaaacatcctccaac
aaacattcccaaatgccaccgttcccatacgagaatggagtgtcctataacacaatattt
ggctcgatctggaaactagtcctcatgctgtcggtcgatccacaccctgaagttgctcga
gatgcgggcatcattgtcgattctattcataaatccctactggagtctcccatgaaaact
ttagccaaaactgccaaagatgagattctgaaactattctctcgggtacacgttaataaa
cctcggcgtgcagaacaagctgatttgaaccggtcactgcctgctctcccaccagctcag
tctacattagcaccaaaaactgaaggatatttgtctcttagtttcaggagaacggccagc
gtagctgcatccttgaaaaatctggcttttggctccgggggtaacaatgaacgccctcaa
tcgcccattaagtccgcttctgtgaaacaccgtgtccctattaccccacgcggtcgggca
cccgccgaatggactcgacctcccgaagttaatgatcagccagctacatcaggatcatac
aggcaagcacgtatccccctatcccgtggctttcagcaaagagatattacgagtatacct
accattcccctggaaagcaagtttttggactggtcgactgagtactttcgcgagccccaa
atgaaacccaacgaatcagatgaacccggaagcgcagattacaatgagcgcctctggcgt
cggagccgaaatgaaaaaattattaccgatactcagcctctcaaagaaagggcaggcaat
agccgatgggatacttctgctgctcttctgagcaatccgactcaaccaacaaaaatgtgc
ttccaccaatttgaagatcacattgcggtagctgatgatagagacactgtttgcaacaaa
aatgctggcttggttttcgactggcaacaagggcaagggaaagcacttgtcgcgggtgac
gttaaagttattcgagtttggaatgcagccactgaagtttgcactaatgatatatctgcg
cgttcgggttcttgtataacctccttgacatctgaccaggtcgctgggaatattttcatc
gccggatttggcgatggcgccgtacgagtatttgaccaacgcctgaagcctacaactgct
atggttaaagtgtggcgagagcataaacagtggatcacaaatatccatatgcaacgggga
ggagttagagagctgatttctggtagccgaaatggcgaggttcgtctttgggacttgcga
atggatacgtcaatagacataatccacgccactagagacaccttgcgaaccctagccgtg
catgaacacgcacctgtattcaccattggcaccaaccgccatgaggttaaaacattcaat
accgatggcacatacctctcaacatacgaaccccattttagctttctgcactctaataga
tcctctcccattatgagcactgccttccatccccacaggacacttctggcctgtgcagct
ctcaacgataaccatatcaatcttgtttcatgttaa

DBGET integrated database retrieval system