KEGG   Ajellomyces capsulatus: HCAG_05566Help
Entry
HCAG_05566        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     HCAG_05566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 366 aa AA seqDB search
MDTLISWGNSLPPLQEFVPPASPEAYIALLTIFQYFPLVTFIQLATPFYPQGKTSLPSSH
LNFPGRYAWVCMESVGALNIMYTLCTGTSKFPGGQLPIWHKTVACLYVLHYLNRAVITPL
FLAPSMSPIHLVIIFSAMGFNYLNSSCIAGWLLGYGTPILGSTAPQPQQTHLSRSSSFSA
KYFPAEYIPYIGLCLFLIGMYGNIKAEGTLFRLRREEVDNNKNNNKLTATQNSKNKYDKV
YVLPPPTGWFRAILFPHYVFEWLEWLGFLLIGFSITPALSASASASSSLETNDVSPLVLA
PYYVPFANLLLHKWGLPFPLPAITFLVNVVSTTAVRASWGRKWYVDRFGAERVGIRGAFV
PYFKWL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggacactcttataagttggggtaactccctcccaccgctccaagagttcgtccctccg
gcatctccagaagcctacatcgctctcctcacaattttccaatatttccccctggtgacc
ttcatccaactagcaacccctttctacccgcaaggaaaaacctcactcccttcctctcac
ctaaacttccctggccgctatgcatgggtctgtatggagagcgtcggtgctctcaacatt
atgtataccctatgcacaggaacctccaagtttcccggaggccagttgccgatttggcat
aagaccgtcgcgtgcctctatgtcctccattatctaaaccgggccgtcataacaccgctc
ttcctcgcgcccagcatgtcaccaattcacctggtcattatcttttcggctatgggattc
aattacctcaactcgagctgtatagcgggctggttgttaggttatgggacaccaatcctg
ggatcaacagcgccccaaccacagcaaacacacctatcgcggtcctcaagtttctctgct
aaatatttcccagcggaatacattccttatatcggactctgtctgttcctaataggaatg
tatggcaacatcaaggcggaggggactttattccgcctacgtagggaggaagttgataat
aataagaataacaacaaactcacagccacccaaaactcaaaaaacaagtacgacaaggtc
tacgtcctcccacctcccaccggctggttccgcgcaatcctcttccctcactatgtcttc
gaatggcttgaatggctcggctttctcttgataggattctccatcacaccagccctatcc
gcctccgcctccgcctcttcttccttggaaactaatgatgtctcccccctcgtcctcgcc
ccttactacgtccctttcgcgaacctcctgctgcataaatgggggttaccatttccgctc
ccggcaattacatttcttgtgaatgtagtatcgacaacggccgtgcgcgcgagttggggc
cggaagtggtatgtggaccgctttggagcggagcgagtggggattcgcggagcatttgtg
ccttattttaagtggttgtga

DBGET integrated database retrieval system