KEGG   Ajellomyces capsulatus: HCAG_05730Help
Entry
HCAG_05730        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aje  Ajellomyces capsulatus
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HCAG_05730
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     HCAG_05730
Transfer RNA biogenesis [BR:aje03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    HCAG_05730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 307 aa AA seqDB search
MSYQQELYVAELAVQRASLLTQRVFNEKAKGTLSKDDKSPVTKGDFGAQALIIQAILKNF
PGDEIVAEEEASALREDKPLSNEIWDLVKDIKLTDEESDKFLGGPLQSEEAMLDILDQGK
SAGGPKGRIWALDPIDGTKGFLRGGQYAVCLGLIVDGDVKVGVIGCPNLPVSDSAPIPAN
STSIKTCSDGTGMLFSAVLGKGASSRPLSGGKLQESKSISMRPVLDITKASFCEGVEAAH
SAQDDNAAVARIEEGYQEKIWDHAAGDLLVVKLGCGWLSIILGKRLDLEKENSGHEYRRH
CFPECYP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccagcaggagctctatgtggcagagctcgccgtacagagggcttcactgtta
acacagcgagtattcaacgaaaaagcaaaaggcactctatccaaagatgacaagtctcct
gtcacaaagggtgacttcggtgcccaggcacttattatccaggcaatcctcaagaacttc
ccaggtgacgagatagttgctgaggaggaagctagtgctctccgggaagataaaccgctg
agtaatgagatttgggacttggtcaaggacatcaagcttacggacgaggaaagtgacaaa
tttttgggtggaccattgcagagcgaggaagctatgctcgatatactcgaccaggggaaa
agcgccggaggaccgaaggggaggatatgggctttggatcctattgatggtacaaagggc
ttcctccgtgggggccaatacgctgtttgtctcggcttgattgtagatggcgatgtcaaa
gtaggagtaattggctgccccaatttgccagtctctgactccgcaccgattcccgccaat
tctacaagcatcaagacctgcagcgatgggactggaatgctcttttctgctgtgctcgga
aaaggtgcctcaagccggcctctctcaggtggaaaactccaggaaagcaaatctatttcc
atgagaccagtcctagatattacaaaggcttcattctgcgagggagttgaagctgcacat
tctgcacaggatgacaacgctgcggttgcaagaattgaggaaggttaccaagagaagatt
tgggaccatgccgctggcgacttgctggtcgtgaagcttgggtgtggatggttatctatt
atcctcggcaagagacttgacttggaaaaggagaactctggtcatgaataccggcgtcat
tgcttccccgaatgctatccataa

DBGET integrated database retrieval system