KEGG   Ajellomyces capsulatus: HCAG_05923Help
Entry
HCAG_05923        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aje  Ajellomyces capsulatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HCAG_05923
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     HCAG_05923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 595 aa AA seqDB search
MRPRCSYRTIDELWTHSCGGIQPLTWSRRLITAHAPPFCFRRFISNPSTHHKNIAVIGAG
VTGLSTAFRLSQDQDARVTLYEKAPKLGGWLQSEIINVDGGEVLFEYGPRTLRAGLGGSL
STLELLFDLGLKDDILPTETDSPAARNRYIYYPDHLVRLPGPYPGAGVLGNILMNVMQLI
SEPLLWKLALEVILEPRRPVRDRSISDESIGDFMKRRFGPNVSDVVASAFFHGIYAGDLY
KLSARSILRIAWDEFELSERGFATELMDQFNQQKILMPYDIAMARRLVEKEKYKEIRRFA
TGNNVLTLRRGMGQLATALESSLRGASNVEIKTGADIKSISKGQDSASMTVSLDDCTSSN
YDYVISTTSSTALAQQLLASEADPAPTSVTDLLNENDYAVTVMVVNLYYKNPNLIPHRGF
GYLIPRSVPVDLNPERALGVIFASDSSAGQDTAEGTKLTVILGGHWWDDWLLSDLPDEEN
AIAMAKSVLARHLRIADEPVVARARLQRDAIPQPTVGQVTQMERLHDALERRFEGRLKVA
GAWYTGVGVNDSIRAGRIVAAATLEGQEGVTGLERYTPENFKRRFGGSRVQEGRE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccacggtgctcgtatcgcaccatagacgagctatggacgcattcttgtggtgga
atacagccattgacctggtctagacgattaatcacagctcacgcccctccattttgcttt
cgccgtttcatctccaatccgagcacacatcacaaaaacattgcagtaataggggccggt
gttactggcctctcaactgcattccgtctctctcaagaccaagatgcgcgcgttacgctc
tacgagaaggccccgaaacttggcggttggttgcaatcggaaataatcaatgtcgacggc
ggggaagtgctgtttgaatatggaccgagaaccctacgggcgggattgggaggtagcttg
tccacgctggaactgttattcgatctaggcctcaaagatgatattctgccgaccgagact
gattccccggctgcacgtaaccgatatatttactatccagaccaccttgtgcgtttgccg
ggaccatatcccggtgctggcgtgctagggaacatcctcatgaatgtcatgcaactaatt
tcagagcccctactctggaaacttgctctggaagtgattctcgagcctagaaggccggtc
cgtgaccgatcgatatctgacgagtccattggcgattttatgaagcgtcgttttggtccg
aatgtgtcagatgttgttgcttccgcatttttccacggcatttatgctggtgatctatac
aaactcagcgcgcggtcgattttgcgcatagcctgggacgagttcgagctctctgaacga
ggctttgcgacggagttgatggaccaattcaatcagcagaaaattcttatgccgtatgat
attgcaatggctcgtcggttggttgagaaggagaaatataaagagatacgccggtttgcg
acgggtaataacgttttaactctccggcggggcatgggccagctcgctacagcattagag
tcgtcgctaagaggtgcatctaatgtggaaatcaagactggtgctgatattaaatccatc
tccaaggggcaagattcagcgtctatgacagttagccttgacgattgcacctcttccaac
tatgactacgtaatatctacgacgtcttccacagccctcgcccagcaactcctcgcctca
gaggcagacccagccccaacatccgtaacggacctgcttaatgagaatgactacgccgtt
accgtcatggtcgtcaatctctactacaaaaatccaaatctaatcccacaccgcggcttc
ggttacctaattccccgctccgtccccgtcgatctcaatcccgagcgcgcccttggcgtc
atctttgcctcagatagtagcgccggccaggacacagctgagggaaccaaacttaccgta
atcctgggcggacattggtgggatgactggctcctctcagacctgccggatgaggaaaac
gccatcgccatggcgaaatcggtgctcgcgcgacatctgcgcattgctgatgagcctgtc
gttgccagagcgcggttgcaacgggatgcgattccgcagccgacagttgggcaggtgacg
cagatggaacggctgcatgatgccctggagcgccggtttgaggggagattgaaggttgct
ggggcatggtatacgggggttggggtcaatgactcgatacgggctgggaggattgtggca
gcggcgacactggaggggcaagagggcgttacgggattggagagatatacaccggaaaac
tttaagcgaaggtttggtggttcgagggtacaggaagggcgggagtga

DBGET integrated database retrieval system