KEGG   Ajellomyces capsulatus: HCAG_05925Help
Entry
HCAG_05925        CDS       T02229                                 

Definition
similar to N-acetyl-beta-glucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aje  Ajellomyces capsulatus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HCAG_05925
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    HCAG_05925
   00603 Glycosphingolipid biosynthesis - globo series
    HCAG_05925
   00604 Glycosphingolipid biosynthesis - ganglio series
    HCAG_05925
   00511 Other glycan degradation
    HCAG_05925
Enzymes [BR:aje01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HCAG_05925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MNRLHIHATDSQSWPLDIPSMPELAAKGAYHPSLILTSSKLSDIQMYGLERGVSVFLEID
MPGHTGSIGYAFPELVSAFLANEWEKYALQPPSGQIKLNSSDVDKFLDELMADLLPRVSP
FTRYFHTGGDEFNLNTYLLEEAIGSSKEEVLRPLLQAVVTRLHTAIRKAGLTPIVWEELV
ADWDLSLSPSPTEKTEIIVQAWRNSTAVKYLLDRGYRTIFGSGDAWYLDCGQGTYVNPKR
SSTAIKEPFLDWCSPKKNWKHMYMYNPLEGISEDLHHLLEGGETHMWSENVDPVALDMMV
WPRAAAAAEVLWSGPRTANQIQDASYRLSEWRERAVVDLGVGASLAQMTYCLMREGSCEL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcttcatatccatgctacggactcccagtcttggccgttggacatcccctcc
atgcctgaactggctgccaagggcgcctaccatcccagtctgatattgacatcttccaag
ctgtctgatatccaaatgtatggccttgaacggggtgtttcagtattcctcgaaatcgat
atgccaggccacacgggctccattggatatgcgtttcccgagctagtttccgcattcctc
gctaacgagtgggagaagtatgcactccaacctcccagcgggcaaatcaagttaaattcg
tcagacgtggataaattccttgacgagttgatggcagacctgcttcctcgagtctcgcca
tttacccgctacttccatacggggggcgatgaattcaatcttaacacatatcttctcgaa
gaggcaatcggatccagcaaggaagaagtcctccgtcctttacttcaagctgtcgtcact
cggcttcacaccgccatccgcaaagcaggactcacccctattgtctgggaagagctcgtg
gcagactgggacctatcactctccccctccccaactgagaaaaccgaaataatcgtgcaa
gcatggcgcaactctactgctgttaaatatctattagaccgaggataccgcacgatcttc
ggctccggtgacgcctggtacctcgattgcgggcaaggcacctacgtaaaccctaaacgc
agctcgaccgcaatcaaagaacccttcctcgactggtgtagcccgaagaaaaactggaag
cacatgtacatgtacaatccgctggaagggatttcagaggatctgcaccatctgcttgaa
ggcggcgagacgcacatgtggtcggagaatgttgacccggttgccctggacatgatggtc
tggccacgggcagctgcggcagctgaggtactctggagtggaccgcggaccgcgaatcag
attcaggatgcttcgtatcgcttgagtgaatggcgtgagcgagctgtggtcgatttgggt
gttggggcgagcttggcgcagatgacgtattgtctcatgagggagggcagctgcgagttg
taa

DBGET integrated database retrieval system