KEGG   Histoplasma capsulatum: HCAG_05953Help
Entry
HCAG_05953        CDS       T02229                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
aje  Histoplasma capsulatum
Pathway
aje00260  Glycine, serine and threonine metabolism
aje00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01230  Biosynthesis of amino acids
Module
aje_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCAG_05953
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCAG_05953
Enzymes [BR:aje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HCAG_05953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP Trp_syntA
Motif
Other DBs
NCBI-GeneID: 5444495
NCBI-ProteinID: XP_001538348
UniProt: A6RAG5
AA seq 600 aa AA seqDB search
MDSSCFDLPPEEAIRFRDLCRKEGLSYVQLIAPATSDSRMKLLCKIPDSFIYVVSRMGVT
GATGKLSKGLPELLARVHSYSGNIPTALGFGISTREHFLKVQEISEGAVIGSQIITVLGE
APAGQRVQKIEEYCTSITGRKVERNTEPEPLTREVGLTEALAHAQEPTNAQVDEVVANDK
KPGAGLVDQLEALNVTGDQAAMPARFGEFGGQYVPESLMDNLLELEAGFNEARNDPKFWE
EFRSYYPYMSRPSSLHLAERLTKYAGGANIYLKREDLNHTGSHKINNALGQVLLARRLGK
TRIIAETGAGQHGVATATVCAKFGMECVIYMGAEDVRRQALNVFRIKLLGAKVVAVEAGS
RTLRDAVNEALRAWVVHLDTTHYVIGSAIGPHPFPTIVRTLQSVIGEETKEQMQKLTGRL
PDAVVACVGGGSNAVGMFYPFTKDPSVRLLGVEAGGDGTDTARHSATLSHGSKGVLHGVR
TYILQNEDGQIADTHSISAGLDYPGVGPELSSWKDQSRAQFIAATDAQALQGFRLITELE
GIIPALESSHAVFGAVELAKTMKKGENIVLNLSGRGDKDVQSVADALPELGPKIGWDLRF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggattcatcctgttttgatcttcctcccgaagaagcgatacggttccgggatctgtgc
cgaaaggaggggttatcttatgttcaactgatcgcgcccgccacctccgattctcgaatg
aaactgctctgtaaaatccctgattcctttatttacgtcgtttctcgaatgggtgttaca
ggtgcaactgggaaactaagcaaaggtctcccggagctccttgctcgggttcactcctac
tccggcaacatccccactgcgctaggattcggcataagtaccagagagcattttttgaaa
gtgcaggagatctctgaaggcgcggtcatcggcagccagattatcacggtcctgggcgaa
gcacccgctggccaacgagtccagaagatcgaagaatattgtaccagtatcacagggagg
aaagtggaacgtaacacagagcctgagcctttgactcgagaagtgggtcttactgaagct
ctcgctcacgcccaggagccaacgaatgcacaggttgatgaagtggttgccaatgacaaa
aagcctggagccggcctggtggatcagttggaagcactcaatgtgaccggagatcaggcc
gcaatgcctgctcgctttggcgagtttggtgggcagtacgtgccagagtccctcatggac
aacctcttagagctcgaagcaggtttcaacgaggctaggaatgaccccaaattctgggag
gagtttcggtcatactacccatatatgagtcggcctagcagcctgcatcttgcggagcgc
ctgaccaaatatgctggcggagccaacatctatctcaagcgcgaagacctgaaccacaca
ggaagccacaagatcaacaatgcactgggccaagttttgctcgcacgccgcctgggcaaa
acacgaatcatcgcagagacaggggctggccagcacggcgtcgccacagctaccgtctgt
gcgaaattcggcatggaatgtgtcatctacatgggggctgaagatgtccgtcgccaagcc
ctgaacgtattccgcatcaaactcctcggagccaaggtcgtcgccgtcgaggctggctcg
cgcaccctgcgtgacgccgtcaacgaagcactgcgcgcttgggtcgtccaccttgataca
acacactacgtaatcggctcagccatcggaccgcaccccttccccaccatcgttcgcacc
ctacaatccgttatcggcgaagagaccaaggagcaaatgcaaaagctaacaggcaggcta
cccgatgccgtagtcgcatgcgtaggcggcggcagcaacgccgtcggcatgttctacccc
ttcactaaagaccccagcgtcaggcttctaggtgtcgaagccggcggcgacggcaccgac
acggcccggcactccgcgactctctcgcacggctccaagggcgtcctgcacggcgtgcgc
acttacattttgcaaaacgaagatggccagattgcagacacgcactccatctccgcaggc
ctcgactatcccggtgttggcccagagctctcgtcttggaaagaccagtcgcgcgcgcag
ttcattgctgcgacggatgcacaggcgctgcaaggcttccggctcattacggagctggag
ggtatcatccctgcgctggagtcgtcacatgcagtgtttggcgcggtggagctggcgaag
acgatgaagaaaggcgagaacatcgtgctgaatttgagtgggaggggcgataaggacgtg
cagagtgtggcggatgcgttaccggagctagggccgaagattggatgggatttgaggttt
tga

DBGET integrated database retrieval system