KEGG   Histoplasma capsulatum: HCAG_05953Help
Entry
HCAG_05953        CDS       T02229                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
aje  Histoplasma capsulatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HCAG_05953
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCAG_05953
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HCAG_05953
Enzymes [BR:aje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HCAG_05953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 600 aa AA seqDB search
MDSSCFDLPPEEAIRFRDLCRKEGLSYVQLIAPATSDSRMKLLCKIPDSFIYVVSRMGVT
GATGKLSKGLPELLARVHSYSGNIPTALGFGISTREHFLKVQEISEGAVIGSQIITVLGE
APAGQRVQKIEEYCTSITGRKVERNTEPEPLTREVGLTEALAHAQEPTNAQVDEVVANDK
KPGAGLVDQLEALNVTGDQAAMPARFGEFGGQYVPESLMDNLLELEAGFNEARNDPKFWE
EFRSYYPYMSRPSSLHLAERLTKYAGGANIYLKREDLNHTGSHKINNALGQVLLARRLGK
TRIIAETGAGQHGVATATVCAKFGMECVIYMGAEDVRRQALNVFRIKLLGAKVVAVEAGS
RTLRDAVNEALRAWVVHLDTTHYVIGSAIGPHPFPTIVRTLQSVIGEETKEQMQKLTGRL
PDAVVACVGGGSNAVGMFYPFTKDPSVRLLGVEAGGDGTDTARHSATLSHGSKGVLHGVR
TYILQNEDGQIADTHSISAGLDYPGVGPELSSWKDQSRAQFIAATDAQALQGFRLITELE
GIIPALESSHAVFGAVELAKTMKKGENIVLNLSGRGDKDVQSVADALPELGPKIGWDLRF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggattcatcctgttttgatcttcctcccgaagaagcgatacggttccgggatctgtgc
cgaaaggaggggttatcttatgttcaactgatcgcgcccgccacctccgattctcgaatg
aaactgctctgtaaaatccctgattcctttatttacgtcgtttctcgaatgggtgttaca
ggtgcaactgggaaactaagcaaaggtctcccggagctccttgctcgggttcactcctac
tccggcaacatccccactgcgctaggattcggcataagtaccagagagcattttttgaaa
gtgcaggagatctctgaaggcgcggtcatcggcagccagattatcacggtcctgggcgaa
gcacccgctggccaacgagtccagaagatcgaagaatattgtaccagtatcacagggagg
aaagtggaacgtaacacagagcctgagcctttgactcgagaagtgggtcttactgaagct
ctcgctcacgcccaggagccaacgaatgcacaggttgatgaagtggttgccaatgacaaa
aagcctggagccggcctggtggatcagttggaagcactcaatgtgaccggagatcaggcc
gcaatgcctgctcgctttggcgagtttggtgggcagtacgtgccagagtccctcatggac
aacctcttagagctcgaagcaggtttcaacgaggctaggaatgaccccaaattctgggag
gagtttcggtcatactacccatatatgagtcggcctagcagcctgcatcttgcggagcgc
ctgaccaaatatgctggcggagccaacatctatctcaagcgcgaagacctgaaccacaca
ggaagccacaagatcaacaatgcactgggccaagttttgctcgcacgccgcctgggcaaa
acacgaatcatcgcagagacaggggctggccagcacggcgtcgccacagctaccgtctgt
gcgaaattcggcatggaatgtgtcatctacatgggggctgaagatgtccgtcgccaagcc
ctgaacgtattccgcatcaaactcctcggagccaaggtcgtcgccgtcgaggctggctcg
cgcaccctgcgtgacgccgtcaacgaagcactgcgcgcttgggtcgtccaccttgataca
acacactacgtaatcggctcagccatcggaccgcaccccttccccaccatcgttcgcacc
ctacaatccgttatcggcgaagagaccaaggagcaaatgcaaaagctaacaggcaggcta
cccgatgccgtagtcgcatgcgtaggcggcggcagcaacgccgtcggcatgttctacccc
ttcactaaagaccccagcgtcaggcttctaggtgtcgaagccggcggcgacggcaccgac
acggcccggcactccgcgactctctcgcacggctccaagggcgtcctgcacggcgtgcgc
acttacattttgcaaaacgaagatggccagattgcagacacgcactccatctccgcaggc
ctcgactatcccggtgttggcccagagctctcgtcttggaaagaccagtcgcgcgcgcag
ttcattgctgcgacggatgcacaggcgctgcaaggcttccggctcattacggagctggag
ggtatcatccctgcgctggagtcgtcacatgcagtgtttggcgcggtggagctggcgaag
acgatgaagaaaggcgagaacatcgtgctgaatttgagtgggaggggcgataaggacgtg
cagagtgtggcggatgcgttaccggagctagggccgaagattggatgggatttgaggttt
tga

DBGET integrated database retrieval system