KEGG   Ajellomyces capsulatus: HCAG_05953Help
Entry
HCAG_05953        CDS       T02229                                 

Definition
tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
aje  Ajellomyces capsulatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aje01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aje00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aje00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 600 aa AA seqDB search
MDSSCFDLPPEEAIRFRDLCRKEGLSYVQLIAPATSDSRMKLLCKIPDSFIYVVSRMGVT
GATGKLSKGLPELLARVHSYSGNIPTALGFGISTREHFLKVQEISEGAVIGSQIITVLGE
APAGQRVQKIEEYCTSITGRKVERNTEPEPLTREVGLTEALAHAQEPTNAQVDEVVANDK
KPGAGLVDQLEALNVTGDQAAMPARFGEFGGQYVPESLMDNLLELEAGFNEARNDPKFWE
EFRSYYPYMSRPSSLHLAERLTKYAGGANIYLKREDLNHTGSHKINNALGQVLLARRLGK
TRIIAETGAGQHGVATATVCAKFGMECVIYMGAEDVRRQALNVFRIKLLGAKVVAVEAGS
RTLRDAVNEALRAWVVHLDTTHYVIGSAIGPHPFPTIVRTLQSVIGEETKEQMQKLTGRL
PDAVVACVGGGSNAVGMFYPFTKDPSVRLLGVEAGGDGTDTARHSATLSHGSKGVLHGVR
TYILQNEDGQIADTHSISAGLDYPGVGPELSSWKDQSRAQFIAATDAQALQGFRLITELE
GIIPALESSHAVFGAVELAKTMKKGENIVLNLSGRGDKDVQSVADALPELGPKIGWDLRF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggattcatcctgttttgatcttcctcccgaagaagcgatacggttccgggatctgtgc
cgaaaggaggggttatcttatgttcaactgatcgcgcccgccacctccgattctcgaatg
aaactgctctgtaaaatccctgattcctttatttacgtcgtttctcgaatgggtgttaca
ggtgcaactgggaaactaagcaaaggtctcccggagctccttgctcgggttcactcctac
tccggcaacatccccactgcgctaggattcggcataagtaccagagagcattttttgaaa
gtgcaggagatctctgaaggcgcggtcatcggcagccagattatcacggtcctgggcgaa
gcacccgctggccaacgagtccagaagatcgaagaatattgtaccagtatcacagggagg
aaagtggaacgtaacacagagcctgagcctttgactcgagaagtgggtcttactgaagct
ctcgctcacgcccaggagccaacgaatgcacaggttgatgaagtggttgccaatgacaaa
aagcctggagccggcctggtggatcagttggaagcactcaatgtgaccggagatcaggcc
gcaatgcctgctcgctttggcgagtttggtgggcagtacgtgccagagtccctcatggac
aacctcttagagctcgaagcaggtttcaacgaggctaggaatgaccccaaattctgggag
gagtttcggtcatactacccatatatgagtcggcctagcagcctgcatcttgcggagcgc
ctgaccaaatatgctggcggagccaacatctatctcaagcgcgaagacctgaaccacaca
ggaagccacaagatcaacaatgcactgggccaagttttgctcgcacgccgcctgggcaaa
acacgaatcatcgcagagacaggggctggccagcacggcgtcgccacagctaccgtctgt
gcgaaattcggcatggaatgtgtcatctacatgggggctgaagatgtccgtcgccaagcc
ctgaacgtattccgcatcaaactcctcggagccaaggtcgtcgccgtcgaggctggctcg
cgcaccctgcgtgacgccgtcaacgaagcactgcgcgcttgggtcgtccaccttgataca
acacactacgtaatcggctcagccatcggaccgcaccccttccccaccatcgttcgcacc
ctacaatccgttatcggcgaagagaccaaggagcaaatgcaaaagctaacaggcaggcta
cccgatgccgtagtcgcatgcgtaggcggcggcagcaacgccgtcggcatgttctacccc
ttcactaaagaccccagcgtcaggcttctaggtgtcgaagccggcggcgacggcaccgac
acggcccggcactccgcgactctctcgcacggctccaagggcgtcctgcacggcgtgcgc
acttacattttgcaaaacgaagatggccagattgcagacacgcactccatctccgcaggc
ctcgactatcccggtgttggcccagagctctcgtcttggaaagaccagtcgcgcgcgcag
ttcattgctgcgacggatgcacaggcgctgcaaggcttccggctcattacggagctggag
ggtatcatccctgcgctggagtcgtcacatgcagtgtttggcgcggtggagctggcgaag
acgatgaagaaaggcgagaacatcgtgctgaatttgagtgggaggggcgataaggacgtg
cagagtgtggcggatgcgttaccggagctagggccgaagattggatgggatttgaggttt
tga

DBGET integrated database retrieval system