KEGG   Ajellomyces capsulatus: HCAG_06040Help
Entry
HCAG_06040        CDS       T02229                                 

Definition
similar to N-acetylglucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aje  Ajellomyces capsulatus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HCAG_06040
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    HCAG_06040
   00603 Glycosphingolipid biosynthesis - globo series
    HCAG_06040
   00604 Glycosphingolipid biosynthesis - ganglio series
    HCAG_06040
   00511 Other glycan degradation
    HCAG_06040
Enzymes [BR:aje01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HCAG_06040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 461 aa AA seqDB search
MHLRRLLQAAATATCLAGVAVEAVDVNPLPAPADITWGTSGPIHISERLEFRGPNNYLLR
AAWRRASDAIRTIRWTPAVVEKPIPTFEPFPGSSKAQRDSVWPPQRSLVRMVNVKVKNER
AELQHGVDESYTLDIKERSHSIDITANTIWGAMHAFTTLQQIIIAEGYWRLIVEQPVSIK
DQPLPGPVKINRYPQMTKGAYSPREVYTPEDIRHIVQYARERGIRVVPETDMPGHSAKGW
EQVDPKMIACANSWWSNDVWALHTAVEPNPGQLDIIYDGTYKVVENVYKELSTQFPDNFF
HTGGDEVHPNCFNFSSIIRDWFAEDSKRDFNDLLQIWVDKAYPIFKDRPSRRLIMWEDVL
LGGMHAHTVPKDVIMQSWNLGPENIKKLTSQGYDVIVSSADFLYLDCGFGGWVGNDPRYN
VMFNPDPAHQTSTTLDLGGSWCAPYKTWQRLEIEEGKREVG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcacctccggcggctgctacaggccgcggccacagctacatgcttggcaggtgttgca
gttgaagctgtcgatgttaacccactacccgctccagctgatatcacctgggggacttcc
gggcccatccatatcagtgaaagacttgagtttagaggacccaacaactatcttctcagg
gccgcctggaggcgcgcatccgacgcaatcagaactatcagatggactcctgccgtggtc
gaaaaaccaattccaacatttgagccgttcccgggcagttcaaaggcacagcgcgacagc
gtttggccaccacagcgctccctggtcagaatggtcaatgttaaagtcaaaaacgagcgg
gccgaattacagcatggcgttgatgaatcctacactctggacatcaaagaacgatctcat
tctattgatatcactgccaacaccatctggggagctatgcatgcctttactacactccag
cagatcatcattgccgagggctactggcgactgatcgtcgaacagccagtctccatcaag
gaccagccacttcctgggcctgtcaagattaaccgctatccccaaatgacgaagggcgcc
tactccccccgtgaagtatacacgccagaagatatccgccacattgtccaatacgccagg
gaacgtggaatccgtgtcgtcccggaaactgatatgccaggccactctgcaaagggttgg
gagcaagtcgatcctaagatgatcgcttgcgccaattcttggtggtctaatgatgtttgg
gcgcttcacactgcagtcgaaccaaacccaggtcaactcgatatcatctacgacggaact
tacaaggtcgtggaaaatgtctacaaggagctcagtactcaattcccagataatttcttc
cacaccggtggcgacgaggtgcatcctaactgcttcaatttcagcagcattatccgggat
tggttcgctgaggactctaagcgtgacttcaacgacctacttcagatatgggtcgacaaa
gcttatccgattttcaaagaccgcccctcccgtcgcctcatcatgtgggaagatgtcctt
ctcggcggaatgcatgcgcacactgtccccaaggacgtgatcatgcaatcatggaacctg
ggtccagaaaacatcaagaaactcacttctcaaggctacgacgtcattgtctcttctgcc
gacttcctctaccttgactgtggtttcggaggctgggtcggcaatgatcccagatataat
gtcatgttcaacccagacccagcacaccaaacttcaactaccttggacctgggcggctcg
tggtgcgccccgtacaagacctggcaacggctagagattgaggagggaaagagagaagtg
ggctag

DBGET integrated database retrieval system