KEGG   Ajellomyces capsulatus: HCAG_06079Help
Entry
HCAG_06079        CDS       T02229                                 

Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     HCAG_06079
Transcription machinery [BR:aje03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     HCAG_06079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 390 aa AA seqDB search
MMAPMTLDRGKRKASEEWVPAVDPPHPMKKAKTESPSKEDEEDEQQVLKLVPYPEKPAVI
EERDGTIEFRVVNNDGERESFIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIALVKH
PLEVVGKFAEIVFCAISSDQQVKGYGAHLMSHLKKQGFTKDISLEKSIWMGYIKDYEGGT
IMQCTMLPKIRYLEAGRMLIKQKEAVHAKIRAFSKSHVVHAPPKEWKNGAYKIDPLSIPA
IKESGWSPDMDELARQPRHGPNYNQLLRLLNDMQNHTSAWPFTQPVNGDEVPDYYEVIKE
PMDLSTMEEKHEKDLYPTPQDFIKDAKLIFDNCRKYNNENTSYAKSANKLEKFMWQQIRN
IPEWSVSLNWHSPCENAYGFNYGVSQLINL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgccaatgactcttgaccgtggcaagcgcaaggcttccgaggaatgggttccg
gcagttgatcccccccatccgatgaaaaaggcgaaaacggagtctcccagcaaggaagat
gaggaggacgagcagcaggttctcaaactcgtgccgtacccggaaaagcctgctgttata
gaagaacgagatggaacgatcgaattccgggttgttaacaatgatggcgagcgggaaagc
tttatcattctcaccggtctcaaatgcatatttcagaagcagttaccaaagatgccgaaa
gattatatcgccaggctagtgtatgataggactcatttatcgattgcccttgtaaaacac
cccttagaggtagtagggaaattcgcagagattgtgttttgtgccatatcctccgaccaa
caggtcaagggatatggagcccacctaatgtcacatttaaagaaacagggattcacgaaa
gatatctcactcgagaaatccatttggatgggttatatcaaagactatgagggaggcaca
attatgcaatgcacaatgctcccgaagatccggtatcttgaagccgggcggatgctcata
aaacaaaaggaagctgtccatgcaaaaatccgagcctttagcaaatcgcatgttgtccat
gcgccacccaaggaatggaaaaatggtgcatataaaatcgaccctctaagtatccccgcg
attaaggaatctggatggtcgccggatatggatgagttagcccgtcagccccgccatggt
ccgaactataaccaactacttcgcctcctcaacgacatgcaaaatcacacatccgcctgg
ccatttactcaacctgtcaatggagatgaggtgcccgactattacgaagtgataaaagaa
ccaatggatctatccacaatggaggaaaagcacgagaaggatttgtatccaacgccgcaa
gacttcatcaaagacgccaagttaatttttgacaattgccgaaagtacaacaatgagaac
acctcgtacgcgaaaagcgcaaacaagcttgagaagtttatgtggcagcaaatcagaaat
attcctgagtggtcggtgagtctcaactggcattccccatgcgaaaacgcttacggtttt
aactacggtgtatctcagctaatcaatctatga

DBGET integrated database retrieval system