KEGG   Histoplasma capsulatum: HCAG_06184Help
Entry
HCAG_06184        CDS       T02229                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
aje  Histoplasma capsulatum
Pathway
aje00630  Glyoxylate and dicarboxylate metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01200  Carbon metabolism
Module
aje_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HCAG_06184
Enzymes [BR:aje01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     HCAG_06184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL
Motif
Other DBs
NCBI-GeneID: 5444892
NCBI-ProteinID: XP_001538579
UniProt: A6RB46
AA seq 397 aa AA seqDB search
MASIEQEEQQYLADVQAVKTWWRDSRWRYTTRPFTAEQIVAKRGNLKIEYPSNVQSKKLW
KLLEEHFAMVKYLDTVYVSGWQSSSTASSTDEPSPDLADYPMNGFRSCNPSSTSTIDPRD
HAFVVGSTNPNIKPLNDLMIAAEQAGKSGAQLQEIEDKWNAEAGLKLFSEAVIDHIKAGS
ASNKQALIDKFLRDARGKSNAEARAIAKALTGSEIYFNWDSARTREGYYRYRGGTQCAVN
RAVAFAPFADLIWMESKLPDYAQAKEFADGVHAVWPEQKLAYNLSPSFNWKAAMPRDEQE
TYIHRLGQLGYCWQFITLAGLHTTALISDQFARAYAQNGMRAYGELVQEPEMELGVDVVT
HQKWSGANYVDELLKMVTGGISSTSAMGKGVTEDQFK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaattgagcaggaagagcagcaatacctggctgatgtccaggccgtcaaaaca
tggtggcgggattcgagatggcgttacaccacaaggccgttcactgccgaacaaattgtg
gctaagagggggaatttgaagattgaatatccgtcaaatgttcagagcaaaaagctatgg
aaactcctggaggaacacttcgcgatggtgaaatacctcgacactgtctacgtctccggc
tggcagagttcttccaccgcgtcgtcgaccgatgaaccttcccccgatcttgccgattac
ccaatgaacggattcagaagctgcaacccctcatcaacctccactatcgacccccgggat
cacgccttcgttgtcggttccacaaatccgaatatcaagccactcaacgacctgatgatc
gctgccgaacaagccggcaagtccggggcccagcttcaggaaattgaggacaaatggaac
gccgaggctggcctcaagcttttctcggaggccgtgatcgaccacataaaagccggctct
gcctccaacaagcaggccctaatcgacaaattcttgcgtgatgcacggggcaagagcaat
gcggaggctcgcgctatcgccaaggcgcttactggctcagaaatctacttcaactgggat
tcggccagaacccgggagggttactaccggtaccgtggcggcacccagtgcgctgtcaac
cgtgctgtggcctttgcgccttttgctgatctgatttggatggagagtaagcttcccgac
tacgcccaggccaaggagtttgccgacggagttcacgccgtctggcccgagcaaaaactc
gcctacaacctttcaccctctttcaactggaaggccgctatgccccgcgacgagcaggaa
acctacatccaccgcctcggacagcttggttactgctggcaattcattacacttgccggt
ctccataccaccgccctgatctccgaccagttcgccagagcgtatgcccagaacggcatg
cgcgcatacggcgagcttgtccaagagccggagatggagcttggcgtcgacgttgttacc
caccagaaatggagtggtgccaactatgtcgacgagctactgaagatggtcaccggtggt
attagtagcacaagcgccatgggcaaaggtgtgacggaagatcaattcaaatag

DBGET integrated database retrieval system