KEGG   Ajellomyces capsulatus: HCAG_06189Help
Entry
HCAG_06189        CDS       T02229                                 

Definition
mitogen-activated protein kinase MKC1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
aje  Ajellomyces capsulatus
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:aje04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MADLQGRKVFKVFNQDFIVDERYNVTKELGQGAYGIVCAATNVQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPDE
NAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPYMHKIPFQRLFPNANPDALDLLDRMLAFDPS
SRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVEDVPEMRKMILEEVLRFRQHVRQ
GAQTPTVAGQQAQQQAQQNVPIPEDHSGPWKHEDPRPQEAIYDSSRNPNDLEASLQRGMD
VVR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttgcaaggacgtaaggtcttcaaggtgttcaatcaggattttatcgttgac
gagcgatacaatgtgaccaaggagttaggacagggcgcatatggcattgtctgtgctgcc
acgaatgttcagactggggagggtgttgcaatcaagaaggttacaaatgtattcagcaag
aaaatcttggccaaacgtgccctgcgcgagatcaaacttctccagcatttccgcggccat
cgcaatatcacgtgcttgtatgacatggatatcccgagaccagacaattttaatgaaact
tacttgtatgaagaattgatggagtgtgacttggctgcgatcatccgatctggacagcct
ttaaccgacgctcacttccaatcctttatttaccaaatactctgtggcttgaaatatata
cattctgccaatgtcctgcatcgagaccttaaaccaggcaatctgttggttaatgctgac
tgcgagcttaaaatttgcgacttcggcctcgctcgtggcttctccattgatcccgatgag
aacgccggctatatgaccgagtacgttgctacccgatggtaccgcgctcctgaaatcatg
ttaagcttccccagctatacaaaagccattgatgtttggtctgttggctgcatcttggcc
gagctgcttggtggtcgaccatttttcaagggccgtgattacgttgaccaactcaaccaa
attctccactaccttggaacgcccaatgaggaaaccctctcacgcatcggctctccccgt
gcacaagagtacgtcagaaatctcccatacatgcacaagatccctttccagcgcctcttc
ccgaatgcgaacccagacgcgcttgatctgctggacagaatgctggccttcgacccctct
tctcgtatatctgttgaagaagctcttgagcatcgctacttgcacatctggcacgacgcc
tcggatgaaccctcatgccccactacattcgacttccattttgaggtcgtcgaggatgta
ccagaaatgaggaaaatgatccttgaagaggtcctccgattcaggcagcatgtgagacag
ggcgctcagacaccaaccgtggcagggcagcaggcacagcagcaggcacaacagaatgtc
ccgattccggaagaccactctggcccctggaaacatgaagatccccggccccaagaggct
atatatgatagctcccgaaatcccaatgacttggaggcatcactccaaaggggaatggat
gttgttagataa

DBGET integrated database retrieval system