KEGG   Histoplasma capsulatum: HCAG_06189Help
Entry
HCAG_06189        CDS       T02229                                 

Definition
(RefSeq) mitogen-activated protein kinase MKC1
Organism
aje  Histoplasma capsulatum
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo DUF2075 APH ATG101
Motif
Other DBs
NCBI-GeneID: 5444900
NCBI-ProteinID: XP_001538584
UniProt: A6RB51
AA seq 423 aa AA seqDB search
MADLQGRKVFKVFNQDFIVDERYNVTKELGQGAYGIVCAATNVQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPDE
NAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPYMHKIPFQRLFPNANPDALDLLDRMLAFDPS
SRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVEDVPEMRKMILEEVLRFRQHVRQ
GAQTPTVAGQQAQQQAQQNVPIPEDHSGPWKHEDPRPQEAIYDSSRNPNDLEASLQRGMD
VVR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttgcaaggacgtaaggtcttcaaggtgttcaatcaggattttatcgttgac
gagcgatacaatgtgaccaaggagttaggacagggcgcatatggcattgtctgtgctgcc
acgaatgttcagactggggagggtgttgcaatcaagaaggttacaaatgtattcagcaag
aaaatcttggccaaacgtgccctgcgcgagatcaaacttctccagcatttccgcggccat
cgcaatatcacgtgcttgtatgacatggatatcccgagaccagacaattttaatgaaact
tacttgtatgaagaattgatggagtgtgacttggctgcgatcatccgatctggacagcct
ttaaccgacgctcacttccaatcctttatttaccaaatactctgtggcttgaaatatata
cattctgccaatgtcctgcatcgagaccttaaaccaggcaatctgttggttaatgctgac
tgcgagcttaaaatttgcgacttcggcctcgctcgtggcttctccattgatcccgatgag
aacgccggctatatgaccgagtacgttgctacccgatggtaccgcgctcctgaaatcatg
ttaagcttccccagctatacaaaagccattgatgtttggtctgttggctgcatcttggcc
gagctgcttggtggtcgaccatttttcaagggccgtgattacgttgaccaactcaaccaa
attctccactaccttggaacgcccaatgaggaaaccctctcacgcatcggctctccccgt
gcacaagagtacgtcagaaatctcccatacatgcacaagatccctttccagcgcctcttc
ccgaatgcgaacccagacgcgcttgatctgctggacagaatgctggccttcgacccctct
tctcgtatatctgttgaagaagctcttgagcatcgctacttgcacatctggcacgacgcc
tcggatgaaccctcatgccccactacattcgacttccattttgaggtcgtcgaggatgta
ccagaaatgaggaaaatgatccttgaagaggtcctccgattcaggcagcatgtgagacag
ggcgctcagacaccaaccgtggcagggcagcaggcacagcagcaggcacaacagaatgtc
ccgattccggaagaccactctggcccctggaaacatgaagatccccggccccaagaggct
atatatgatagctcccgaaatcccaatgacttggaggcatcactccaaaggggaatggat
gttgttagataa

DBGET integrated database retrieval system