KEGG   Ajellomyces capsulatus: HCAG_06189Help
Entry
HCAG_06189        CDS       T02229                                 

Definition
mitogen-activated protein kinase MKC1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
aje  Ajellomyces capsulatus
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:aje00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    HCAG_06189
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     HCAG_06189
Protein kinases [BR:aje01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   HCAG_06189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MADLQGRKVFKVFNQDFIVDERYNVTKELGQGAYGIVCAATNVQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPDE
NAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPYMHKIPFQRLFPNANPDALDLLDRMLAFDPS
SRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVEDVPEMRKMILEEVLRFRQHVRQ
GAQTPTVAGQQAQQQAQQNVPIPEDHSGPWKHEDPRPQEAIYDSSRNPNDLEASLQRGMD
VVR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttgcaaggacgtaaggtcttcaaggtgttcaatcaggattttatcgttgac
gagcgatacaatgtgaccaaggagttaggacagggcgcatatggcattgtctgtgctgcc
acgaatgttcagactggggagggtgttgcaatcaagaaggttacaaatgtattcagcaag
aaaatcttggccaaacgtgccctgcgcgagatcaaacttctccagcatttccgcggccat
cgcaatatcacgtgcttgtatgacatggatatcccgagaccagacaattttaatgaaact
tacttgtatgaagaattgatggagtgtgacttggctgcgatcatccgatctggacagcct
ttaaccgacgctcacttccaatcctttatttaccaaatactctgtggcttgaaatatata
cattctgccaatgtcctgcatcgagaccttaaaccaggcaatctgttggttaatgctgac
tgcgagcttaaaatttgcgacttcggcctcgctcgtggcttctccattgatcccgatgag
aacgccggctatatgaccgagtacgttgctacccgatggtaccgcgctcctgaaatcatg
ttaagcttccccagctatacaaaagccattgatgtttggtctgttggctgcatcttggcc
gagctgcttggtggtcgaccatttttcaagggccgtgattacgttgaccaactcaaccaa
attctccactaccttggaacgcccaatgaggaaaccctctcacgcatcggctctccccgt
gcacaagagtacgtcagaaatctcccatacatgcacaagatccctttccagcgcctcttc
ccgaatgcgaacccagacgcgcttgatctgctggacagaatgctggccttcgacccctct
tctcgtatatctgttgaagaagctcttgagcatcgctacttgcacatctggcacgacgcc
tcggatgaaccctcatgccccactacattcgacttccattttgaggtcgtcgaggatgta
ccagaaatgaggaaaatgatccttgaagaggtcctccgattcaggcagcatgtgagacag
ggcgctcagacaccaaccgtggcagggcagcaggcacagcagcaggcacaacagaatgtc
ccgattccggaagaccactctggcccctggaaacatgaagatccccggccccaagaggct
atatatgatagctcccgaaatcccaatgacttggaggcatcactccaaaggggaatggat
gttgttagataa

DBGET integrated database retrieval system