KEGG   Ajellomyces capsulatus: HCAG_06196Help
Entry
HCAG_06196        CDS       T02229                                 

Definition
lysophospholipase precursor
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
aje  Ajellomyces capsulatus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HCAG_06196
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HCAG_06196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 643 aa AA seqDB search
MRADLIALWTTIIGTYSSLAAAVAPESIQALSVRALPNAPDGYTPAEASCGESRPTVRSA
ASLSQNENLWLEKRRQKATDAMKDFFGRVTIAGFDARSYIENNAKNISALPNVGIAVSGG
GYRALMNGGGALKAFDSRTKNSTGPGQLGGLLQSATYLSGLSGGGWLVGSLYINNLTSVS
ELEADEDGSVWEFNNSILEGPTWKGIKLLNTIDYYKEIYDAVEGKKQAGFDVSLTDYWGR
ALSYQLIDAPEGGPAYTWSSISLGQDFKDGNMPLPILVADGRNPGELFIGGNATVFEFNP
WEFGTFDPTIFGFMPLELLGSKFESGSLPRSEPCVRGFDNAGYVMGTSSSLFNQFLLNLN
GVDIPGFVKDAFESILESIGRSNNDIAAYDPNPFFHYSNHTSPFAKEKSLNLVDGGEDLQ
NIPLHPLIQPERHVDVIFAVDSSADNKFNWPNGTALVATYERSITSSIANGTVFPAVPDV
NTFVNLGLNKKPTFFGCDSANMTGPSPLIVYIPNSPYVAFSNASTFQMEYSDSQRFEIIQ
NGYSVATMGNGTVDSDWPTCVGCAMLSRSFERTNTQVPEACKKCFKTHCWDGRINSTVPS
VYEPGLLLGPLKTTSIASSSIAPYSFTLLIAVGVAEMLLQLST
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgagggcggacttgattgcgttatggaccaccatcatagggacgtattcaagcctcgct
gctgctgtggcacccgaatctattcaagctctttccgtgagagcgctcccgaacgctccc
gatgggtatacacctgctgaagccagttgcggtgaaagtcgcccgacggttcgcagcgca
gcgtccctttcacaaaatgaaaatctctggttagagaaaagaagacaaaaggccactgat
gcgatgaaagatttttttggccgcgttaccattgcaggtttcgatgcgcggtcttacatt
gaaaacaatgccaaaaatatctctgcacttccgaatgttggaattgcggtttccggcggg
ggatacagagccttaatgaatggcggtggcgcattgaaggcgtttgatagtcggacaaaa
aactcgaccggccccgggcagctgggcggcctgctgcagtcagccacatacctatctggt
ctgagtggtggtggatggctcgtcggatcactttacatcaacaatttgacctctgtgtca
gagttggaggcggatgaggatgggtcggtatgggagttcaacaattctattctcgagggc
cctacatggaagggcatcaaactactcaataccatcgattattacaaagaaatatatgat
gccgtcgaggggaagaaacaggctgggtttgacgtttcacttacggattattggggccga
gctctatcgtaccagcttatcgatgcccctgaaggtggaccagcttatacatggtcctct
atttcccttggacaggatttcaaggacggaaatatgcctctccccattctggttgcggat
ggcaggaatcccggagagttgttcatcggaggcaatgccacagtattcgagtttaatcct
tgggaatttggcacattcgacccgaccatctttggctttatgcccttggagctcctcggg
tcgaaattcgaatcagggtccttgccccggtcggagccctgcgtgagaggctttgataac
gctggctatgtcatgggcacatcatcatccctcttcaaccagttcttactgaacttaaat
ggtgttgatattccaggatttgtcaaggatgcatttgaatctatccttgaaagcattggg
agaagcaacaacgatattgcagcgtacgatcccaatccgtttttccactactccaaccat
acctcacctttcgcgaaagaaaaatctctcaacctcgtcgatggtggagaagacctgcaa
aacattcctcttcatcctctgattcagccagagcggcacgtcgacgtcatttttgccgtg
gactcttctgccgacaacaaattcaactggccaaatggcaccgcgcttgtcgcaacttat
gagcgcagcataacttccagcattgctaatggcaccgtgtttccagccgtccctgacgtg
aacaccttcgtaaatctgggactcaacaagaaacccacgtttttcggatgcgacagtgca
aacatgacaggcccatctcctctgatagtctacatccccaattcaccatatgtagctttt
tccaatgcatcaaccttccaaatggaatattccgactcccagcgtttcgagatcattcaa
aatgggtacagcgttgctaccatgggtaacggtactgttgactcggactggcctacctgc
gttggctgtgccatgctcagcaggtcgtttgaacgcacaaacacgcaagttcctgaagcc
tgtaagaagtgtttcaagacccattgttgggatggacgaattaacagcactgttccttca
gtgtacgagccaggactgctgcttggacccttgaaaactaccagtatcgcatcttcgagc
attgccccatattctttcactttgcttattgctgttggtgtggcagagatgctattgcag
ctgtccacgtaa

DBGET integrated database retrieval system