KEGG   Histoplasma capsulatum: HCAG_06806Help
Entry
HCAG_06806        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
aje  Histoplasma capsulatum
Pathway
aje00010  Glycolysis / Gluconeogenesis
aje00052  Galactose metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
Module
aje_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCAG_06806
   00052 Galactose metabolism
    HCAG_06806
Enzymes [BR:aje01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HCAG_06806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim DUF4661
Motif
Other DBs
NCBI-GeneID: 5445203
NCBI-ProteinID: XP_001539201
UniProt: A6R915
AA seq 330 aa AA seqDB search
MSVLINDRDGKQQDVVVGYDDPKQYKIDTETNHTYFGCIVGRYANRIKNGSFELDGVRYD
ITKNENHDTQTLHGGVIGYDQRPWTVVNHTENSITFSLLDTCFEGFPGEVITYATLSETP
IMLSHHIYWNLNGFKKPNVLEDTTLQLPLSKRFIKIDSSAIPTGELVDTATAFGGALDFT
QPKLIGKDIASAKNCGANCTGYDNAFIIDRPNSESDWTSSPETMAVVLRMASRTTGISMQ
VTTNQKAVQIYSCNNQNGTIPVKKSQTNRNKMEGGHEYVDVINKYGCIVIEKEDWIDGIS
NPEWGQNPYQIYSPETGPAVNWATFTFGNI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtattgatcaacgaccgcgatggcaagcaacaggatgttgtcgtcggttacgat
gacccgaaacaatataaaatcgacactgagaccaaccatacgtattttggctgcatcgta
gggagatacgccaacagaatcaaaaacggctcctttgagctcgacggtgttaggtacgac
atcacaaagaatgaaaaccatgacacccagacactgcatggaggtgttatcggatatgat
cagcgcccttggacggtggtaaatcacactgaaaactctatcaccttcagtctcctcgac
acctgctttgaaggtttcccaggtgaagttatcacatatgccaccctcagtgagacaccc
atcatgttgtcacaccatatttactggaacctaaatgggtttaagaagcctaacgtgttg
gaggatactaccttgcagctgccgctgtcaaaaagatttataaaaatcgattcctccgca
ataccaacaggcgaactcgtagataccgcaacggcatttggcggtgccctcgacttcacc
cagcccaagctcattggcaaagacatcgcctcggctaagaattgtggtgccaattgtaca
ggttatgacaacgcattcatcattgaccgccccaatagtgaatcagactggacctcgtct
ccggaaactatggctgtcgttctgaggatggcgtcccggaccactgggatcagcatgcaa
gtcaccacgaaccaaaaggctgttcaaatctatagttgcaataatcagaacgggactatc
cctgtcaagaaatctcagaccaaccggaataaaatggaaggtggtcacgagtatgtggat
gttatcaacaaatatggctgtatcgtcatcgagaaagaagactggattgacggtatcagc
aacccagaatggggccagaatccataccagatctattccccagaaacaggaccagccgtg
aactgggctacattcacttttggaaatatttaa

DBGET integrated database retrieval system