KEGG   Ajellomyces capsulatus: HCAG_06953Help
Entry
HCAG_06953        CDS       T02229                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aje  Ajellomyces capsulatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HCAG_06953
Enzymes [BR:aje01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HCAG_06953
Exosome [BR:aje04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HCAG_06953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 701 aa AA seqDB search
MAAGQGLDDVVAAAVARETTPDGSGVVKLDPWLEPFKDALRSRFSHTNQWIQTINETEGG
LEVFSRGYEKFGFNVRDNGDIVYREWAPNVVDAHLIGDFNNWDRKATPMQRNDFGVWEVT
VLAKDGIPIIPHNSKVKITMTAPSGEQLDRFPAWIKRVTQNLSVSPEFHAIFWNPPAQDR
YAFKQPHPPKPASLRIYEAHVGISSPETRVATYKEFTKNMLPRIHGLGYNAIQLMAIMEH
AYYASFGYQVNNFFAASSRYGTPEELKELIDTAHGLGLVVLLDVVHSHASKNVLDGLNMF
DGTDNLYFHAGPKGQHELWDSRLFNYGNHEVLRFLLSNLRFWMEEYQFDGFRFDGVTSML
YMHHGIGTGFSGGYHEYFGPSVDEDGITYLMLANEMLHQIYPNCITVAEDVSGMPALCLP
LTLGGQGFDYRLAMAIPDMYIRLLKEQKDEEWNMGHLTFTLTNRRYGEKTIAYAESHDQA
LVGDKSLMMWLCDKELYTHMSVLTELTPVIARGLSLHKMIRLLTHGLGGEGYLSFEGNEF
GHPEWLDFPRAGNNNSYWYARRQLNLTEDPLLRYKFLNDFDRAMQVAEEKYGWLHAPQAF
VSQKHEENKVIVFERAGLVWVFNFHATRSWADYMIGVGGKGRTYRIVLDTDAEGFGGFGR
VEAGTRFFTRGEGWDGREDSLMVYVPTRTALVLAPEEETEG
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagggcaaggactcgatgatgtcgtcgcggccgcggtggccagagagacaacc
cctgatggttccggagtcgtcaagctagatccgtggctggagccgttcaaggatgcgttg
cggagcagattcagccatacgaatcaatggatccagacaatcaatgagacggagggcgga
ttggaagttttcagtcggggttatgagaaattcggtttcaatgttagagataatggagat
attgtttaccgggaatgggcgcctaatgtcgtggatgcacatctcattggggatttcaat
aattgggatcgcaaggcgacgcccatgcagaggaatgactttggagtttgggaggtaaca
gtgcttgcgaaggatgggatccccatcattccgcataacagcaaggtcaagataaccatg
actgccccatccggcgagcaactcgaccgcttcccagcctggatcaaacgggtcacgcaa
aacctttccgtctctcctgaattccacgccatattctggaaccctcccgcgcaggaccgc
tacgccttcaaacaaccgcacccgcctaaacctgccagcctgcgcatctacgaggcccac
gtcggcatctcctcccccgagacccgcgtggctacctataaggagtttacaaagaacatg
ctcccgcgcatccacggcttgggatacaatgccatccagctcatggccatcatggaacat
gcatactacgcaagttttggatatcaggtcaacaatttctttgcagccagtagccgctac
ggcacgccagaagagctgaaggagctcatcgacaccgcgcatggcctggggctggtggtg
ttattggatgtggtgcatagccatgcttccaagaatgtgttggacgggctgaatatgttt
gacgggacggataatctgtatttccatgcaggtcccaaggggcagcatgagttgtgggat
agccggttgtttaattacgggaatcatgaggtgttgaggttcttgttgagtaacttgcgg
ttctggatggaggagtatcagtttgacgggtttaggttcgatggggttacgagtatgttg
tatatgcatcatggaattgggaccggattctccggtgggtatcacgaatacttcggtccc
agtgttgacgaagacggcatcacctaccttatgctcgccaacgaaatgctccatcagatc
tacccaaactgcatcacagtcgcggaggatgtttccggaatgccagcgctctgcctaccg
cttacccttggtgggcaaggctttgattatcgcctcgccatggcgattccggatatgtat
atcaggctgctcaaggaacaaaaggacgaggaatggaacatgggccatctcacctttact
ctcaccaatcgacggtatggcgagaagacaatcgcctacgccgagagccatgaccaagcc
ctcgtcggcgacaaatcgctcatgatgtggctctgcgacaaggaactgtacacgcacatg
tccgtcctaaccgaactcacccccgtcatcgcgcgtggcctcagcctgcacaagatgatc
cggctgctcacccacggcctgggcggcgaagggtacctgagcttcgagggcaacgaattc
ggacaccccgagtggctcgactttccgcgcgcgggcaacaacaacagctactggtacgcg
cggcggcagctcaacctcaccgaggacccgctgctgcgctacaagttcctgaacgacttc
gaccgggcgatgcaggttgccgaggagaaatatggctggctgcatgcgccgcaggcattt
gtgagccagaagcacgaggagaacaaggtgatagtgtttgagcgggcgggacttgtgtgg
gtgtttaatttccatgccacgaggagctgggcggactatatgattggggtgggggggaag
gggagaacgtacaggattgtgctggatacggatgcggagggcttcgggggcttcggaagg
gttgaggcggggacgaggttctttacgagaggggaagggtgggatgggagggaggacagt
ttgatggtatacgtgccgacgaggacggcgctggtgctggcgcccgaggaggagaccgag
ggataa

DBGET integrated database retrieval system