KEGG   Ajellomyces capsulatus: HCAG_07098Help
Entry
HCAG_07098        CDS       T02229                                 

Definition
similar to ascorbate peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
aje  Ajellomyces capsulatus
Brite
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HCAG_07098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 224 aa AA seqDB search
MAFAARTFTRAFARAPLASSSSSSIRTSGRHAGRFALPSQSFRGGSRRGYSSDPGAGKSS
TGYYLGLGAVLAGGAGAFYYWNNDGLKAVAKPASFTPTKDDYQKVYDEIAKLLVEKDDYD
DGSYGPVLVRLAWHASGTYDKTSGTGGSNGATMRFSPEGDHSANAGLKAARDFLEPVKAK
FPWISYSDLWTLAGACAIQEMQGPKIPWRPGRLDRDRYLWTHGF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgctgctagaactttcaccagggcttttgctcgtgctccccttgcgagcagc
tcctcttcatccatccgaacttccggtcgtcatgcaggccgttttgcccttccctcccaa
agcttccgaggtggatcccgcagggggtattcctctgatcctggagcaggaaagtcttct
actggctattatcttggattgggtgctgttctagctggaggtgctggtgccttctactac
tggaataacgatggactgaaagctgttgccaaaccagcgtctttcactccaaccaaggac
gattaccagaaggtgtacgatgaaattgcgaagctcttggtagaaaaagacgactatgat
gacggaagctatggaccggttcttgtccgattggcatggcacgcgagcggcacctatgat
aagacaagtggcactgggggaagcaatggcgccactatgcgcttctctcccgaaggcgac
cattcggcgaacgctggcttgaaagctgctagggatttcctcgagccagtcaaggctaaa
ttcccttggatctcctactccgatctttggactcttgctggtgcttgcgccattcaggaa
atgcaagggccgaagattccgtggcgcccaggccgcttagacagggatagatatctttgg
acgcatgggttttga

DBGET integrated database retrieval system