KEGG   Ajellomyces capsulatus: HCAG_07292Help
Entry
HCAG_07292        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
aje  Ajellomyces capsulatus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aje00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 215 aa AA seqDB search
MLLRSWTSILGGFLLYYVNLIYTHDGHDYSNHEKRSIDRRKELLKKWDQEWSFSGVSTFA
HLKHVKCLLEPDEHYDVAVLGVPFDTSVSFRPGARFGPRAIRAAKRQMYEAFLELGTREA
PNPIPGISHGKPKIVTLGGDHSITLPFTENRSPCCTSMRTLIPGTPSGTRRIGHLINPAS
TTVAFFHTASHEGSWYGLFNSNYYLEKAKNRDMNS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcgaagctggacaagcatccttggcgggtttctcctgtactatgttaacctc
atatatacccatgatgggcacgactattctaatcatgagaagcgctccattgaccgtagg
aaagagcttctgaagaaatgggaccaggagtggagtttttctggtgtttcaaccttcgcc
catctgaagcatgtaaaatgcctcctagagccggatgagcactatgatgtcgctgtactc
ggagttcctttcgatacttccgtctccttccggccgggagcccggttcggcccgcgcgcc
atccgtgccgcaaaacgccagatgtacgaggcctttctggagctgggcacccgtgaggcc
ccaaaccctattccgggcatttcgcacggaaagcccaagattgtcacactgggcggtgat
cacagcatcaccctaccgtttacggaaaaccgatcaccgtgttgcacttcgatgcgcacc
ctgatacctggaaccccgtccggtactcggcgtattggacatctgatcaatcccgcttca
accacggtagcttttttccacacggccagccatgaaggttcatggtatgggctcttcaac
agcaactattacttggaaaaagcaaagaatcgtgacatgaatagttga

DBGET integrated database retrieval system