KEGG   Ajellomyces capsulatus: HCAG_07330Help
Entry
HCAG_07330        CDS       T02229                                 

Definition
similar to acetyl-CoA carboxylase 2
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
aje  Ajellomyces capsulatus
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aje01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aje00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aje00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:aje00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 892 aa AA seqDB search
MADQYVEVPGGTNNNNYANVELIVDIAERMGVHAVWAGWGHASENPKLPESLAASPKKII
FIGPPGSAMRSLGDKISSTIVAQHAGVPCIPWSGEGVEEVTVDEEGIVTVEPHIYDKGCT
HSPQEGLEKALAIGFPVMVKASEGGGGKGIRKVEREEDFINMYNAAASEIPGSPIFIMKL
AGNARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPETFQAMERAAVRL
GKLVGYVSAGTVEYLYSHAEDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPL
HRIRDIRLLYGVDPNTSSEIDFHFTNEESTKTQRRPKPKGHTTACRITSEDPGEGFKPSS
GTMHELNFRSSSNVWGYFSVGTSGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKELSI
RGDFRTTVEYLIKLLETPAFEENTITTAERPDPMVAVICGAVTRAHLASESCVAEYRRGI
EKGQVPSKDVLKTVFPIDFIYEGYRYKFTATRSSDDNYHLFINGSKCSVGVRALADGGLL
VLLNGRSHNVYWKEEAAATRLSVDGKTCLLEEENDPTQLRTPSPGKLVKYTVENGEHVRA
GQPFAEVEVMKMYMPLIAQEDGIVQLIKQPGSTLEAGDILGILALDDPSRVKHAQPFLGQ
LPELGPPQVVGVKPPQRFGLLHSILIDILRGFDNQVIMGATLKELVDVLRNPELPYGEWN
AQVSALHSHVIRRYSDGLKVHEYKVFIGILQQYWEVEHLFTGRNMRDEDVILKLREENKD
DIDGVIQTVLSHSRVGAKNNLLLAILDMYRPNKPNAGNVGKYLKPILKKLAELESRATSK
VALKAREVLIQKLSIPSTLSSMFSLFSSDIRINGYRWQRIEVYIRRAYRAYS
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaatatgtcgaggttcctggaggcacgaataacaacaattatgccaatgtt
gaactcattgtggatattgcagagcgaatgggtgtccatgcagtgtgggccggatggggt
cacgcttcggaaaacccaaagcttcctgagtcgctagcggcgtctccgaaaaagattatt
tttatcggtccccctggttctgcaatgcgatctcttggagataaaatttcttcgacgatt
gttgcccaacatgcaggggttccctgcatcccttggtctggagaaggcgtggaggaggtc
acagtcgatgaagaggggattgtaacggttgaacctcacatttatgacaaaggatgtacg
cactctccgcaagaaggcctggagaaagctctggctattggcttcccggtcatggtcaag
gcctcggagggaggtggtgggaaaggtattcggaaagtcgagagggaagaggatttcatc
aatatgtataatgccgccgccagcgagattcctggatcgccgattttcatcatgaaactc
gcaggcaatgcgagacatttggaggttcagttactagcagatcaatatggtaacaacatt
tccctcttcggacgggattgttcggtacaacgacgacatcagaaaattatcgaggaggct
cccgtcacgatcgcgaagccagaaacctttcaagcaatggagcgagccgctgtgaggctc
gggaagttggttggctacgtttccgctggaacagtcgaatatctctactcccatgcagaa
gataaattttacttcctggaactaaatccccgtctacaggttgagcatcccacaacagag
atggtttctggagtgaatcttccggctgcgcaacttcagattgcaatgggaatcccctta
catcgcattcgtgatatccgtctgttgtatggcgttgatcctaataccagctccgagatt
gatttccatttcaccaatgaagaaagcacgaaaacccaacgccgaccaaagcccaagggt
cacaccactgcttgtcgtatcacgtccgaggaccccggtgaaggtttcaagccctccagc
ggaacaatgcacgagctcaacttccggagtagttcaaatgtttggggttatttctctgtt
ggtacctctggtgggatccatagtttctctgattctcaattcggccatatctttgcctac
ggcgaaaatcgttccgcgtcacgcaagcacatggtcgtcgcattgaaggaattgagcatt
cgcggtgatttccggacaactgttgagtatctcatcaaacttttggagacacctgcgttc
gaggagaacactatcactaccgctgagcgccctgatccaatggtcgctgttatctgtgga
gctgtcaccagggctcatctcgcgagtgagtcgtgtgttgcggaatatcggagaggtatt
gaaaagggtcaagtaccttcaaaagacgtcctgaaaactgttttccccatcgattttatt
tacgaaggataccgatacaaattcactgccaccagatcaagcgacgataactatcatctg
ttcattaatggatcaaaatgttctgttggcgttcgggctctagctgatggtggactgctc
gtacttttgaacggacgaagccataatgtttactggaaggaagaggctgctgcgacacgc
ttgagtgtcgacgggaaaacatgtttgcttgaggaagaaaatgaccccacacaacttcgc
actcctagtccaggaaagcttgttaagtacacagtggaaaacggcgaacatgtccgagct
gggcaaccattcgctgaagttgaagtcatgaaaatgtatatgcccctcatcgcgcaggag
gatggtattgttcaactcatcaagcagcctggatctacactcgaggctggggatattttg
ggtattctcgcgttggatgatccatccagagtgaagcatgctcaacctttccttgggcag
ctgccagagctaggtcctccacaagttgtcggcgtcaagccccctcagcgtttcggcctc
ctccacagcatcttgattgatattcttcgtgggttcgataaccaagtcatcatgggggcc
accctgaaagaattggtcgatgtcctgagaaatcccgaactaccgtatggagaatggaac
gcacaagtttctgctttgcattcacatgtcattcgacgatacagtgatggacttaaggtc
catgaatataaggttttcattggtattcttcagcagtattgggaagtggaacatcttttc
acgggaagaaatatgcgagacgaggatgtgattcttaaactgagagaagaaaacaaagat
gacatcgacggagtcatccaaactgtcctatctcacagcagagtcggagcgaagaataac
ttgcttctcgccattttagatatgtatcgtccaaacaaaccgaatgcgggtaatgtcgga
aagtacctcaagcccatcttgaaaaaacttgcagagttggaatcacgagccacttccaaa
gtggctttgaaggcccgtgaggttcttatccagaagttgtcgattccaagtacactgtct
tcgatgttctccctcttttcttcggacatcaggatcaatgggtatcgttggcagcgaatc
gaggtgtatatccgccgggcttaccgagcctactcgtga

DBGET integrated database retrieval system