KEGG   Histoplasma capsulatum: HCAG_07330Help
Entry
HCAG_07330        CDS       T02229                                 

Definition
(RefSeq) similar to acetyl-CoA carboxylase 2
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
aje  Histoplasma capsulatum
Pathway
aje00061  Fatty acid biosynthesis
aje00620  Pyruvate metabolism
aje00640  Propanoate metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01212  Fatty acid metabolism
Module
aje_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HCAG_07330
   00640 Propanoate metabolism
    HCAG_07330
  Lipid metabolism
   00061 Fatty acid biosynthesis
    HCAG_07330
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    HCAG_07330
Enzymes [BR:aje01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     HCAG_07330
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     HCAG_07330
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     HCAG_07330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central CPSase_L_D2 Biotin_carb_C Biotin_lipoyl Biotin_carb_N ATPgrasp_Ter ATP-grasp_3 Dala_Dala_lig_C Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 5444107
NCBI-ProteinID: XP_001537908
UniProt: A6RCH2
AA seq 892 aa AA seqDB search
MADQYVEVPGGTNNNNYANVELIVDIAERMGVHAVWAGWGHASENPKLPESLAASPKKII
FIGPPGSAMRSLGDKISSTIVAQHAGVPCIPWSGEGVEEVTVDEEGIVTVEPHIYDKGCT
HSPQEGLEKALAIGFPVMVKASEGGGGKGIRKVEREEDFINMYNAAASEIPGSPIFIMKL
AGNARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPETFQAMERAAVRL
GKLVGYVSAGTVEYLYSHAEDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPL
HRIRDIRLLYGVDPNTSSEIDFHFTNEESTKTQRRPKPKGHTTACRITSEDPGEGFKPSS
GTMHELNFRSSSNVWGYFSVGTSGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKELSI
RGDFRTTVEYLIKLLETPAFEENTITTAERPDPMVAVICGAVTRAHLASESCVAEYRRGI
EKGQVPSKDVLKTVFPIDFIYEGYRYKFTATRSSDDNYHLFINGSKCSVGVRALADGGLL
VLLNGRSHNVYWKEEAAATRLSVDGKTCLLEEENDPTQLRTPSPGKLVKYTVENGEHVRA
GQPFAEVEVMKMYMPLIAQEDGIVQLIKQPGSTLEAGDILGILALDDPSRVKHAQPFLGQ
LPELGPPQVVGVKPPQRFGLLHSILIDILRGFDNQVIMGATLKELVDVLRNPELPYGEWN
AQVSALHSHVIRRYSDGLKVHEYKVFIGILQQYWEVEHLFTGRNMRDEDVILKLREENKD
DIDGVIQTVLSHSRVGAKNNLLLAILDMYRPNKPNAGNVGKYLKPILKKLAELESRATSK
VALKAREVLIQKLSIPSTLSSMFSLFSSDIRINGYRWQRIEVYIRRAYRAYS
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaatatgtcgaggttcctggaggcacgaataacaacaattatgccaatgtt
gaactcattgtggatattgcagagcgaatgggtgtccatgcagtgtgggccggatggggt
cacgcttcggaaaacccaaagcttcctgagtcgctagcggcgtctccgaaaaagattatt
tttatcggtccccctggttctgcaatgcgatctcttggagataaaatttcttcgacgatt
gttgcccaacatgcaggggttccctgcatcccttggtctggagaaggcgtggaggaggtc
acagtcgatgaagaggggattgtaacggttgaacctcacatttatgacaaaggatgtacg
cactctccgcaagaaggcctggagaaagctctggctattggcttcccggtcatggtcaag
gcctcggagggaggtggtgggaaaggtattcggaaagtcgagagggaagaggatttcatc
aatatgtataatgccgccgccagcgagattcctggatcgccgattttcatcatgaaactc
gcaggcaatgcgagacatttggaggttcagttactagcagatcaatatggtaacaacatt
tccctcttcggacgggattgttcggtacaacgacgacatcagaaaattatcgaggaggct
cccgtcacgatcgcgaagccagaaacctttcaagcaatggagcgagccgctgtgaggctc
gggaagttggttggctacgtttccgctggaacagtcgaatatctctactcccatgcagaa
gataaattttacttcctggaactaaatccccgtctacaggttgagcatcccacaacagag
atggtttctggagtgaatcttccggctgcgcaacttcagattgcaatgggaatcccctta
catcgcattcgtgatatccgtctgttgtatggcgttgatcctaataccagctccgagatt
gatttccatttcaccaatgaagaaagcacgaaaacccaacgccgaccaaagcccaagggt
cacaccactgcttgtcgtatcacgtccgaggaccccggtgaaggtttcaagccctccagc
ggaacaatgcacgagctcaacttccggagtagttcaaatgtttggggttatttctctgtt
ggtacctctggtgggatccatagtttctctgattctcaattcggccatatctttgcctac
ggcgaaaatcgttccgcgtcacgcaagcacatggtcgtcgcattgaaggaattgagcatt
cgcggtgatttccggacaactgttgagtatctcatcaaacttttggagacacctgcgttc
gaggagaacactatcactaccgctgagcgccctgatccaatggtcgctgttatctgtgga
gctgtcaccagggctcatctcgcgagtgagtcgtgtgttgcggaatatcggagaggtatt
gaaaagggtcaagtaccttcaaaagacgtcctgaaaactgttttccccatcgattttatt
tacgaaggataccgatacaaattcactgccaccagatcaagcgacgataactatcatctg
ttcattaatggatcaaaatgttctgttggcgttcgggctctagctgatggtggactgctc
gtacttttgaacggacgaagccataatgtttactggaaggaagaggctgctgcgacacgc
ttgagtgtcgacgggaaaacatgtttgcttgaggaagaaaatgaccccacacaacttcgc
actcctagtccaggaaagcttgttaagtacacagtggaaaacggcgaacatgtccgagct
gggcaaccattcgctgaagttgaagtcatgaaaatgtatatgcccctcatcgcgcaggag
gatggtattgttcaactcatcaagcagcctggatctacactcgaggctggggatattttg
ggtattctcgcgttggatgatccatccagagtgaagcatgctcaacctttccttgggcag
ctgccagagctaggtcctccacaagttgtcggcgtcaagccccctcagcgtttcggcctc
ctccacagcatcttgattgatattcttcgtgggttcgataaccaagtcatcatgggggcc
accctgaaagaattggtcgatgtcctgagaaatcccgaactaccgtatggagaatggaac
gcacaagtttctgctttgcattcacatgtcattcgacgatacagtgatggacttaaggtc
catgaatataaggttttcattggtattcttcagcagtattgggaagtggaacatcttttc
acgggaagaaatatgcgagacgaggatgtgattcttaaactgagagaagaaaacaaagat
gacatcgacggagtcatccaaactgtcctatctcacagcagagtcggagcgaagaataac
ttgcttctcgccattttagatatgtatcgtccaaacaaaccgaatgcgggtaatgtcgga
aagtacctcaagcccatcttgaaaaaacttgcagagttggaatcacgagccacttccaaa
gtggctttgaaggcccgtgaggttcttatccagaagttgtcgattccaagtacactgtct
tcgatgttctccctcttttcttcggacatcaggatcaatgggtatcgttggcagcgaatc
gaggtgtatatccgccgggcttaccgagcctactcgtga

DBGET integrated database retrieval system