KEGG   Ajellomyces capsulatus: HCAG_07336Help
Entry
HCAG_07336        CDS       T02229                                 

Definition
similar to nuclear protein bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
aje  Ajellomyces capsulatus
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:aje04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:aje04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:aje04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 628 aa AA seqDB search
MAPSAPHISSQLRQLIYYHLDNNLIRNALFLAGRLHAFEPRSSEASFLLALCHLQSGQPK
AAWEYSRNSGSRGTHSGCSYVYAQACLDLGKYIEGITALERSRGLWASKNTWNKHSETRR
QHLPDAAACLCLQGKLWHAHQDPHKAVDCYVEALKLNPFLWDAFLGLCQTEMLAMLPSSP
AGESLPVFEKVAQTNGPLQVQPNINHNLDPFASFNARTDAANGSSALWEKLNGSNVVSIN
APAPEGLETPIAQSDSDEFRGGGGGVASGEQTWDPPLAPARKNKTIQTLSLDYGADPPPK
MKATIKPRSKTKVDSEDPNPVIVSRETAPPAYGGERKRTISGQVAHPTSSQPPEPGAPQR
RSVRLFNQIRPTSSKFSTTSAAFGAREGREIKKVKSTGAKSRSASGSTSTMGRVVSGNRK
AAPDGMDIDSKESRGVPVSAVPNGVVGGQSKNSVLDKSKDIEALNWVLDLFAKLAEGHAA
LTTYKCQEAIQIFNTLPQSQRETPWVLSQIGRANYEQGLYAEAEKYFIRVKTIAPSRLED
MEVYSTVLWHLKNEVELAYLAHELMEIDRLSPQAWCAIGNSFSLQSDHDQALKCFKRATQ
LDHTFAYAFTLQGHEHVSNEEYDKALDA
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctctgctccccacatctctagccagttgaggcaattgatatactatcatctc
gataataacctcatccgcaacgccctcttccttgccggccgtctccatgcttttgagccc
cggtcttctgaggcctctttcctcctcgccctttgccacctccagagcggccagccgaag
gctgcttgggaatacagcaggaattctgggtccagagggacgcattctgggtgttcgtac
gtctatgctcaagcatgcctggacttgggcaagtacattgaagggattactgcattggag
cggagtaggggtctgtgggcttccaagaatacttggaataaacatagcgaaacaagacga
cagcatctccctgatgctgcggcatgtctttgcctacaaggaaagctgtggcacgcccac
caggatccgcataaggcggtcgattgctacgttgaggctttgaaactaaaccctttcctt
tgggatgcatttctcggtctctgccaaacagaaatgttggcaatgcttccgtcctcgcct
gcgggcgaaagtcttccagttttcgagaaagttgcacaaacaaacggccccttgcaggtt
cagccaaatattaaccataacttggatccgttcgcttcgtttaatgcccgtactgatgcc
gcgaatggctcctccgcgctttgggaaaagctaaatggcagcaatgttgtttcgatcaat
gccccggctcctgaaggtctggaaactcccattgcacaaagcgattcggacgaatttcga
ggcggtggtggtggtgtcgcttctggtgaacagacttgggatccccctcttgcacctgcc
aggaagaacaaaaccatacagaccctgagtctggattatggtgccgatcccccacccaaa
atgaaagcgacaatcaaaccccgaagtaagactaaggtggactcagaggatccgaacccc
gttattgtctctagggaaactgccccgcctgcatatgggggcgaacgaaaaaggactata
tccggtcaggttgcccacccaacaagctcacaaccccctgagccaggagctccacagcga
cgaagtgtacggctgtttaaccaaatccgcccaaccagcagcaaattttcaacaacttct
gcggcgttcggagcgcgggagggtcgagagatcaaaaaggtgaagtctacaggtgcgaaa
tctcgaagcgcttctgggtcgacctcgacgatgggccgagtggtgagcggtaatcgaaag
gcagctccagatggaatggacatcgacagtaaagagagtcgaggagttcccgtttctgcg
gttccgaatggtgtggtcggtggacaatcgaagaactccgtgctggacaaatccaaggac
atcgaagcgcttaactgggtcttggatctttttgcaaaacttgcggaaggtcacgcagcg
cttacaacatataagtgccaagaggcaatacaaatattcaacacactcccgcaaagccag
cgggaaacaccttgggttctgtcacagattggtcgagcgaattacgagcaaggtttatat
gcagaagctgaaaaatatttcattcgtgttaaaactatcgcaccgtcgaggttggaggat
atggaagtttattctacagttctatggcatttgaaaaatgaagtagaattggcatacctg
gcacacgaactgatggagatagaccgactctcgccgcaagcctggtgtgccataggtaac
tccttctctttgcaatctgaccatgaccaggcgctcaagtgcttcaaacgggcaacgcaa
ttggatcacacttttgcctacgccttcaccttgcaaggccatgagcacgtctcgaatgaa
gaatatgataaggcgttggatgcataa

DBGET integrated database retrieval system