KEGG   Ajellomyces capsulatus: HCAG_07336Help
Entry
HCAG_07336        CDS       T02229                                 

Definition
similar to nuclear protein bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
aje  Ajellomyces capsulatus
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:aje00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    HCAG_07336
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    HCAG_07336
   04113 Meiosis - yeast
    HCAG_07336
Protein phosphatases and associated proteins [BR:aje01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     HCAG_07336
Ubiquitin system [BR:aje04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     HCAG_07336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 628 aa AA seqDB search
MAPSAPHISSQLRQLIYYHLDNNLIRNALFLAGRLHAFEPRSSEASFLLALCHLQSGQPK
AAWEYSRNSGSRGTHSGCSYVYAQACLDLGKYIEGITALERSRGLWASKNTWNKHSETRR
QHLPDAAACLCLQGKLWHAHQDPHKAVDCYVEALKLNPFLWDAFLGLCQTEMLAMLPSSP
AGESLPVFEKVAQTNGPLQVQPNINHNLDPFASFNARTDAANGSSALWEKLNGSNVVSIN
APAPEGLETPIAQSDSDEFRGGGGGVASGEQTWDPPLAPARKNKTIQTLSLDYGADPPPK
MKATIKPRSKTKVDSEDPNPVIVSRETAPPAYGGERKRTISGQVAHPTSSQPPEPGAPQR
RSVRLFNQIRPTSSKFSTTSAAFGAREGREIKKVKSTGAKSRSASGSTSTMGRVVSGNRK
AAPDGMDIDSKESRGVPVSAVPNGVVGGQSKNSVLDKSKDIEALNWVLDLFAKLAEGHAA
LTTYKCQEAIQIFNTLPQSQRETPWVLSQIGRANYEQGLYAEAEKYFIRVKTIAPSRLED
MEVYSTVLWHLKNEVELAYLAHELMEIDRLSPQAWCAIGNSFSLQSDHDQALKCFKRATQ
LDHTFAYAFTLQGHEHVSNEEYDKALDA
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctctgctccccacatctctagccagttgaggcaattgatatactatcatctc
gataataacctcatccgcaacgccctcttccttgccggccgtctccatgcttttgagccc
cggtcttctgaggcctctttcctcctcgccctttgccacctccagagcggccagccgaag
gctgcttgggaatacagcaggaattctgggtccagagggacgcattctgggtgttcgtac
gtctatgctcaagcatgcctggacttgggcaagtacattgaagggattactgcattggag
cggagtaggggtctgtgggcttccaagaatacttggaataaacatagcgaaacaagacga
cagcatctccctgatgctgcggcatgtctttgcctacaaggaaagctgtggcacgcccac
caggatccgcataaggcggtcgattgctacgttgaggctttgaaactaaaccctttcctt
tgggatgcatttctcggtctctgccaaacagaaatgttggcaatgcttccgtcctcgcct
gcgggcgaaagtcttccagttttcgagaaagttgcacaaacaaacggccccttgcaggtt
cagccaaatattaaccataacttggatccgttcgcttcgtttaatgcccgtactgatgcc
gcgaatggctcctccgcgctttgggaaaagctaaatggcagcaatgttgtttcgatcaat
gccccggctcctgaaggtctggaaactcccattgcacaaagcgattcggacgaatttcga
ggcggtggtggtggtgtcgcttctggtgaacagacttgggatccccctcttgcacctgcc
aggaagaacaaaaccatacagaccctgagtctggattatggtgccgatcccccacccaaa
atgaaagcgacaatcaaaccccgaagtaagactaaggtggactcagaggatccgaacccc
gttattgtctctagggaaactgccccgcctgcatatgggggcgaacgaaaaaggactata
tccggtcaggttgcccacccaacaagctcacaaccccctgagccaggagctccacagcga
cgaagtgtacggctgtttaaccaaatccgcccaaccagcagcaaattttcaacaacttct
gcggcgttcggagcgcgggagggtcgagagatcaaaaaggtgaagtctacaggtgcgaaa
tctcgaagcgcttctgggtcgacctcgacgatgggccgagtggtgagcggtaatcgaaag
gcagctccagatggaatggacatcgacagtaaagagagtcgaggagttcccgtttctgcg
gttccgaatggtgtggtcggtggacaatcgaagaactccgtgctggacaaatccaaggac
atcgaagcgcttaactgggtcttggatctttttgcaaaacttgcggaaggtcacgcagcg
cttacaacatataagtgccaagaggcaatacaaatattcaacacactcccgcaaagccag
cgggaaacaccttgggttctgtcacagattggtcgagcgaattacgagcaaggtttatat
gcagaagctgaaaaatatttcattcgtgttaaaactatcgcaccgtcgaggttggaggat
atggaagtttattctacagttctatggcatttgaaaaatgaagtagaattggcatacctg
gcacacgaactgatggagatagaccgactctcgccgcaagcctggtgtgccataggtaac
tccttctctttgcaatctgaccatgaccaggcgctcaagtgcttcaaacgggcaacgcaa
ttggatcacacttttgcctacgccttcaccttgcaaggccatgagcacgtctcgaatgaa
gaatatgataaggcgttggatgcataa

DBGET integrated database retrieval system