KEGG   Ajellomyces capsulatus: HCAG_07506Help
Entry
HCAG_07506        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
aje  Ajellomyces capsulatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 148 aa AA seqDB search
MADPTAQKPVGWADYHKGLMQYSGIDKAAIYSTDPQYANSPCASSPGFTALPNEIAFILN
SFADTKDDEPKEVQTNGFSFAGEKYFFVRADKNPDCLIGRKQKEGIVIYKTSSALFIVHH
PSDVFTNNVNEYVDGWARYLINAENAQG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggccgatccaactgctcagaaaccagttggctgggcagactatcacaaaggcctaatg
cagtactccggaatcgacaaggcggccatctacagcacagatccacagtatgccaactcg
ccctgtgccagctctccaggtttcacggccttgcccaatgaaatcgctttcatccttaat
tctttcgccgataccaaagatgatgaacccaaggaagtacaaacgaacggattttccttc
gctggcgagaagtacttcttcgtaagagcagataagaacccagattgcctcatcggtcgg
aagcaaaaggaaggaatcgtcatatataagacctcctctgctctctttatcgtgcaccac
ccgtccgatgtcttcacgaacaatgtcaacgaatatgtggacggttgggctagatatctg
atcaatgctgaaaacgctcagggttga

DBGET integrated database retrieval system