KEGG   Ajellomyces capsulatus: HCAG_07552Help
Entry
HCAG_07552        CDS       T02229                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aje  Ajellomyces capsulatus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HCAG_07552
   01230 Biosynthesis of amino acids
    HCAG_07552
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCAG_07552
   00030 Pentose phosphate pathway
    HCAG_07552
   00051 Fructose and mannose metabolism
    HCAG_07552
   00052 Galactose metabolism
    HCAG_07552
  Energy metabolism
   00680 Methane metabolism
    HCAG_07552
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HCAG_07552
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HCAG_07552
Protein phosphatases and associated proteins [BR:aje01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HCAG_07552
Messenger RNA biogenesis [BR:aje03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HCAG_07552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 794 aa AA seqDB search
MASKRRRIAVLTSGGDAPGMNGVVRAVVRMSTHCGCEAYAIHEGYEGLVQGGELIRRMYW
EDVRGWLSRGGTLIGSARSMSFMTREGRMRAAKNLVVRGIDALVVCGGDGSLTGADIFRG
EWPGLLAELVEKGELTPDEVKPYHCLNIVGVVGSIDNDMSTTDATIGCYSSLHRICEAVD
EVFDTAASHQRGFVIEVMGRHCGWLAMMSAISTGADWLFIPERPPRDGWEGDMCEIITQN
RKRGKRRTIVIVAEGAQDSNLNKITSGSVKDLLSSRLKLDTRVTVLGHTQRGGPACAYDR
WLGTLQGVEAVKAVLEAKPGSPSPIITIRENKIEPTSLVEAVRVTKQVTQAIMDKDFATA
LDMRDAEFKAYHRAYINTATPHHPKLQLPENKRMRIAIIHVGAPAGGMNPATRAAVAYCI
ARGHTPIAIYNGFPGLCRHHADKPLGSVREVSWLESDSWVNEGGSEIGTNRGLPSEDMPK
TAECFELYKFDALFVIGGFEAFTAVSQLRKARDQYPAFRIPLVILPATISNNVPGTEYSL
GSDTCLNTLINFCDVIRQSASSSRRRVFVIETQGGRSGYIAVMAGLAVGAYAVYIPEEGI
DIKMLSRDIEYLRHNFATDRGASHAGKIILRNERASATYTTQVIADMIKEEAHGRFESRA
AVPGHFQQGGKPSPMDRVRALRMAIKCIEHMETFFGRSGESIAADPMSSVVIGIKGSEVV
FGPMGPDASGRGGLEETDTDWVRRRPTNNFWMGLKELVDTLSGRPGEDHNGVLRMAEEEG
WGPYAPLDDCHFTE
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaagcgtcgccgtatcgctgtgctcacaagtggcggggatgcccctgggatg
aatggtgtggtccgcgcggtcgtccgcatgtctacccactgtggctgtgaggcctacgct
atccacgaaggctatgaaggccttgtgcagggcggggagttgatccggcggatgtactgg
gaagatgtgcgcggctggttgtcgcgggggggtactctaattggctctgctcgcagcatg
agcttcatgacgcgagaggggcgcatgcgtgctgctaaaaatctggttgtgcgtggaatc
gatgcgctcgtcgtctgtggtggagatggcagtttgaccggtgcggatatcttccgggga
gagtggcctggcttattggccgagttggtggagaagggggagttgaccccggacgaggtg
aagccataccattgcctcaatatcgttggtgttgtgggttcaattgacaacgatatgtca
acaacggatgccactattggctgttattcatcactccaccgcatatgcgaggctgttgat
gaggtattcgataccgcagcttcccatcagcgcggatttgtgattgaagtgatgggacga
cattgcgggtggttggctatgatgtcggccatcagcacaggggcggactggttgttcatt
ccagagaggccgccacgagatggttgggaaggagacatgtgtgaaattatcactcagaat
cgaaaacgaggcaaacgccggaccatcgttatcgttgctgaaggtgctcaggatagtaac
cttaataagataacatctggatcagtgaaggaccttctgagcagcaggctgaaacttgat
actcgggtcacggttctcggccacacacagcgaggagggcccgcatgcgcctacgatcgg
tggctgggcacacttcagggggtagaagctgtcaaagctgttttggaagctaaacccggg
tctccctcacctatcataaccatcagagaaaacaaaatcgagccgacatcccttgtcgaa
gctgttcgcgtcacgaagcaagtgacccaggccatcatggacaaagattttgcgacggcc
ttggatatgcgagacgcggaattcaaagcctatcacagggcgtatatcaatacggcaacc
cctcaccatccaaagttgcagttaccagaaaataaacgtatgcgaatcgcaattatccat
gttggtgcacctgctggtggaatgaatcccgcaacacgcgcagctgtcgcctattgtatc
gcccgaggtcacacgccaattgcgatatacaatggttttccaggcttatgccggcaccac
gcggataagcctctgggttccgtccgggaagtttcatggctcgagtcagactcatgggta
aatgaaggcggttccgaaatcggcacaaaccgcggcctcccctccgaagacatgcccaag
accgccgaatgcttcgagctgtacaagttcgatgcccttttcgtcatcggtggttttgaa
gccttcacggcagtaagccagctccgcaaagctcgtgatcagtatcccgctttccgaatt
cctctcgtcatcctcccggcgaccatctccaacaacgtcccgggtactgaatactccctc
ggcagcgacacctgtctcaacacgctcatcaacttctgcgacgtaattcgccaatctgcc
tcctcttcccgccgacgggtcttcgtcattgaaacccaaggcggccgctcaggttacata
gccgtcatggccggccttgccgtcggagcgtacgccgtctacatccccgaggagggaatc
gacatcaaaatgctctcgcgagacatcgaatacctacgccacaactttgcgacagaccgc
ggcgccagccacgcggggaagatcatcctccgcaacgagcgcgcctcggccacctacacc
acccaggtaattgccgacatgatcaaagaggaagcgcatgggcgcttcgagtcccgggcc
gccgttcccggtcacttccaacagggcgggaagccgtcgccgatggaccgcgtgcgggcg
ctgcgcatggcgataaaatgcatcgagcacatggagacgttctttgggcgcagtggggag
tccattgcggcggatccgatgtccagcgtcgttatcgggattaaggggagtgaggttgtg
tttgggccgatggggcccgatgcttcggggaggggcggactagaggagacggatacggac
tgggtgcgtcggagaccgacgaataatttttggatggggctgaaggagcttgtggatacg
cttagtgggcggcccggggaggatcacaacggggtacttagaatggcggaggaggaaggg
tgggggccatacgcgccgcttgacgactgtcattttacagagtag

DBGET integrated database retrieval system